KEGG   Athene cunicularia (burrowing owl): 113491306
Entry
113491306         CDS       T05777                                 

Gene name
CDKN1B
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclin-dependent kinase inhibitor 1B
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04012  ErbB signaling pathway
acun04068  FoxO signaling pathway
acun04110  Cell cycle
acun04115  p53 signaling pathway
acun04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113491306 (CDKN1B)
   04068 FoxO signaling pathway
    113491306 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113491306 (CDKN1B)
   04115 p53 signaling pathway
    113491306 (CDKN1B)
   04218 Cellular senescence
    113491306 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113491306
NCBI-ProteinID: XP_026723911
LinkDB
Position
1
AA seq 188 aa
MTFEVYFQALPEIKDLVQELSLLYTLAREQHXGEKMEQRPGKTTHAQRNLFGPVDHEQLW
QDFQHMLYNSVEGVQQKGNFDFLWDVPAEGLLQWEELKSQEVPTFYHSCVVGDGQRPLQH
LNWPLGREDRSHXVAQVALTEKPKTSKKTGSKRIWEGKKTRQTWLADYYSAKKRIKTNTQ
DASKKAAS
NT seq 567 nt   +upstreamnt  +downstreamnt
atgacctttgaagtctattttcaagctcttccagaaattaaagacctggttcaagaatta
tccctgctgtatacgctggccagagagcagcactgaggagaaaagatggagcagcggcca
gggaagacaacccacgcccagaggaacctctttggccccgtagaccacgagcagctgtgg
caggacttccagcacatgctgtacaacagtgttgagggggtccagcagaaggggaacttc
gatttcctctgggacgtgccagcagaggggctcctgcagtgggaagagctcaaaagccag
gaggtgcccaccttctaccacagctgcgtggtgggagatggtcagagaccactgcagcac
ctgaactggcccctgggcagggaggacaggagtcacnncgtggctcaggtggcactgact
gagaaacccaaaacttccaagaaaacagggagcaagaggatctgggaagggaagaagacg
agacagacatggttagcagattactactcggcaaagaagcgaatcaaaacgaatacgcaa
gacgcttcaaagaaggcagcttcttga

DBGET integrated database retrieval system