KEGG   Athene cunicularia (burrowing owl): 113491550
Entry
113491550         CDS       T05777                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04010  MAPK signaling pathway
acun04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113491550 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    113491550 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:acun04052]
    113491550 (KITLG)
Cytokines and growth factors [BR:acun04052]
 Growth factors
  Growth factors (RTK binding)
   113491550 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 113491550
NCBI-ProteinID: XP_026724359
LinkDB
Position
1
AA seq 285 aa
MDQCKTWIITCFCLQLLLLNPFVKAQSSCGNPVTDDVNDIAKLVGNLPNDYMITLKYVPK
MDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFVKENGHLYEEGRFIPEDFFRHFNSTIEVYREFADTLDKNDCILPSTVETPENDS
RVAVTKTFLFPPVAASSLRNDSIGSNTSSNKEALGFISSSSLQGISIALTSLLSLLIGFI
LGAIYWKKTHPKSRPESDETTQCHDCQEENEISMLQQKEKEHLQV
NT seq 858 nt   +upstreamnt  +downstreamnt
atggaccaatgtaagacttggattatcacttgcttttgtcttcaactactcctacttaat
ccttttgtcaaagcccaaagctcctgcgggaatccagtgacagatgatgtgaatgacatt
gcaaaattggttggaaatctcccaaatgattatatgataacccttaaatatgtcccgaag
atggatagtctgcctaatcactgttggttgcatttgatggtgcctgaattttcaaggagt
ctacataatcttctccagaaattttcagatatttcagatatgtctgatgttctaagcaac
tattcaatcatcaataatctcacaaggataattaatgatcttatggcatgcctagctttt
gataaaaataaggattttgtaaaagaaaatggtcacctttatgaagaaggtcgcttcatt
cctgaggatttttttaggcactttaatagtaccattgaagtctacagggagtttgcagat
acattggacaagaatgactgcattctgccttcaacagtagaaacaccagagaatgattcc
agagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctcccttaggaat
gacagcattggcagtaacactagcagtaacaaagaggcacttggcttcattagcagctcc
agtctgcaagggatcagcatagcactgacatcactgctgtctcttcttattggctttatt
ttgggagccatatactggaagaaaacacatcctaaatccagaccagaaagtgatgaaact
acacagtgtcatgactgtcaagaggaaaatgagataagtatgttgcagcaaaaagaaaag
gaacatctacaagtgtag

DBGET integrated database retrieval system