KEGG   Acinetobacter sp. TGL-Y2: AMD27_02720Help
Entry
AMD27_02720       CDS       T04425                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
acv  Acinetobacter sp. TGL-Y2
Brite
KEGG Orthology (KO) [BR:acv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMD27_02720
Enzymes [BR:acv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AMD27_02720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_2 GST_N_3 GST_C_3 GST_C_2 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AMW77916
UniProt: A0A145WW06
LinkDB All DBs
Position
587256..587873
Genome map
AA seq 205 aa AA seqDB search
MIDLYYWGTPNGQKITIALEEMALDYRIFPINILENDQFQYDFLKISPNNKIPAIVDQDG
PAGEAISVFESGAILQYLGRKTGLFYPKDEQKRVEVEQWLMWQMGGLGPMLGQNHHFGKF
AKEKIPYAIERFTAETKRLYTVLDQQLIGQEYVAGEYSIADIAIFPWLLRYEWQNIAIDD
YPNVKNYVKRLNARPAVQKALAIQV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttatattattgggggacacccaatggtcaaaaaataacgattgctttagaa
gaaatggctttggattatcgtatttttccgatcaatattttagaaaatgatcagtttcaa
tatgattttttaaaaatttcacccaacaataaaatccccgcaattgttgatcaagacggt
ccagctggcgaagctatttcagtctttgagtctggggcaattttgcaatatttggggcgc
aaaactggtttattttatccgaaagacgagcaaaagcgtgtcgaagtcgaacagtggctg
atgtggcaaatgggcggcttgggtccgatgctggggcaaaatcatcattttggtaaattt
gccaaagaaaaaatcccttatgcgattgaacgttttactgcagaaaccaaacgtctttac
accgttttagatcagcagctcatagggcaagaatatgtggcaggagagtactccattgct
gatatcgcgatatttccgtggttactccgttatgaatggcaaaatattgcgatagatgat
tatccaaacgtaaaaaattatgttaaacgtttaaatgcacgccctgctgtgcaaaaggca
cttgcgattcaggtgtaa

DBGET integrated database retrieval system