KEGG   Acinetobacter sp. TGL-Y2: AMD27_05245Help
Entry
AMD27_05245       CDS       T04425                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
acv  Acinetobacter sp. TGL-Y2
Pathway
acv00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:acv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMD27_05245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acv01003]
    AMD27_05245
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acv01011]
    AMD27_05245
Enzymes [BR:acv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AMD27_05245
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AMD27_05245
Glycosyltransferases [BR:acv01003]
 Polysaccharide
  Bacterial polysaccharide
   AMD27_05245
Peptidoglycan biosynthesis and degradation proteins [BR:acv01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AMD27_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AMW78341
UniProt: A0A143G295
LinkDB All DBs
Position
complement(1129497..1131899)
Genome map
AA seq 800 aa AA seqDB search
MKSERGIGLIALLFSVLIIAAFVIFSIYLIRIDNVIRDKFEGNRWDIPAKVFARPLEVYA
NAPIDQADFQKELGLLGYKNSENYTKPGNFLVQDNTVFVHTRGFDFGDSVEPEQILQVAF
TDAQVSEIKATKPSSTGIARLEPMLIGGIYPQHNEDRVLIKLNKVPKPLIQALIATEDRN
FYHHHGVSVRGTARAVVSNITGGKRQGGSTLTQQLVKNFYLTPERTLKRKVNEAFMAFLL
ELHYDKDEILEAYLNEVNLGQNGNYSINGYGLASQFYFGLPLRELSIAQQAFLVGLVQGP
SLYNPWRNPESAKKRRNIVLNNMLVMGYLTQDQYDTESAKPLNVISKPTIGPARFPDFLD
IVRRQLKAEYQEGDLTNQGLRIFTTLDPIAQTKIQTSFIDTVSRISKANPARLKNLQGAV
LVSHPENGELIAAVGSTADFTGFNRAIDAKRQVGSLLKPAIYLSALESGRYNWASVVEDS
PISIPVDGNKSWTPKNYSGSGYGYVPMVQALANSYNLSAVRLGQEFGLSSFSNNLSKFGV
TSNIPSYPSIFLGAVDMSPMEVLSIYGNFATGGFKYPNKSIRSVVDSNGRALDRYSLNVQ
QTIDPSAAYLLNYGLQRVMTAGTGKAAYNSLPTSLNLAGKSGTTNDTRDSWFAGYSGNNL
AVVWLGLDDNKVTGLTGTSGALPVWINVMKQLRQKPVNLRQPDNVQWQWLDVSSGELSAQ
GCEGALYIPLLRHTIPKRATACGLPHYQVEPTYSPDTQTVPETNPSEDSIENYIRESESE
MEQELSNSNSRVISSGSFQP
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgaacgtggtattggcttaattgcgctccttttttctgtgctgatcattgcg
gcatttgtcatttttagtatctatcttattcgtatagataatgtcattcgtgacaaattt
gaaggcaaccgctgggatattccagctaaagtatttgcccgtcctttagaagtgtatgcc
aatgcaccgattgatcaggcggatttccaaaaagaattgggtttactcggctataaaaat
tctgaaaattacaccaaacccggcaactttttggttcaagacaataccgtttttgtgcat
acccgtgggttcgacttcggtgatagcgttgaacctgaacaaattttgcaagtggcattt
acagatgcacaggtttctgaaattaaggcaaccaaaccttccagtacaggcattgctcgt
ttagaacccatgctgattgggggtatttatccgcagcacaatgaagatcgtgtactgatt
aaactcaataaagtcccaaaaccactgattcaggctttgattgccactgaagatcgtaat
ttttatcaccatcacggggtttctgtgcgtggtacagcccgtgcggtggtaagtaatatc
acggggggtaaacgccaagggggttcaactttaacccagcaattggtgaaaaacttctat
ttaacgcctgaacgtaccctaaaacgtaaagttaatgaagcctttatggcgtttttgctt
gagctgcattatgacaaagatgagattttagaggcttacttaaatgaagtgaatctagga
caaaacggcaactattctatcaatggttatggtttggcttcacagttttactttggtttg
ccgctgcgtgaactgagtattgctcagcaagcgttcttggttggtttggttcaaggacct
agtctatataatccttggcgtaaccctgaaagcgctaaaaaacgtcgcaatattgtgtta
aacaatatgttggttatgggctatttgacccaagatcagtatgataccgaatctgcaaaa
cctttaaatgtgattagcaagccgaccattggccctgctcgctttccggactttttggac
attgtccgtcgtcagcttaaagccgagtatcaagaaggggatctgaccaatcaaggtcta
cgtattttcaccactttagatccgattgcacaaaccaaaattcaaacttcttttattgat
acggtttcacgtatttctaaggccaaccctgcacgtttgaaaaacttgcaaggcgcagta
ttagtctctcaccctgaaaacggtgaattgattgcagcagtcggttcaacggctgacttt
accggttttaaccgcgcgattgatgccaaacgtcaagtcggctcattactcaaacctgcg
atttacctcagtgcattagaatctggtcgctacaattgggcaagcgtggtagaagacagt
ccgatcagtattcccgtcgatgggaacaaatcatggacgcctaaaaactatagcggaagt
ggttatggttatgtaccaatggtacaagcacttgccaattcatataacctatctgctgtg
cgtttaggacaagaattcggactctccagtttcagtaataatttgtctaaatttggagtc
acttccaatattccaagctacccgtctattttcttgggtgctgtggatatgtcacccatg
gaagtgctgagtatttacggtaactttgcaacaggtggttttaaatatccaaataaatcg
attcgttcggtggtggattcaaatggtcgagcactcgatcgctatagtttgaatgtacaa
caaaccattgacccttcagcagcttacttgctgaactatggtttacaacgtgtaatgact
gccggtacaggcaaagctgcatataacagcctacccaccagtttgaatttggcaggaaaa
tcaggcaccaccaatgacacacgtgactcatggtttgcaggttactctggaaacaatctg
gctgtggtatggctgggtctagatgacaataaagtgactgggctgacaggtacatccggt
gcactgcccgtttggattaacgtgatgaagcaactacgccaaaagccagtcaatttgcgc
caaccagataatgtccagtggcagtggcttgatgtaagcagcggtgaactctctgcgcaa
ggctgtgaaggcgcgctgtatattccgctgctgcgtcataccattcctaaacgtgcaacg
gcgtgtggcctgccgcattatcaagtcgaacccacttacagtcctgatacgcaaactgtt
cctgaaaccaatccatctgaagatagtattgaaaactacattcgagaaagtgaaagtgaa
atggaacaagaattatccaattccaatagccgtgtgatttcgagtggcagttttcaacct
taa

DBGET integrated database retrieval system