KEGG   Acinetobacter sp. TGL-Y2: AMD27_06025Help
Entry
AMD27_06025       CDS       T04425                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acv  Acinetobacter sp. TGL-Y2
Brite
KEGG Orthology (KO) [BR:acv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMD27_06025
Enzymes [BR:acv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AMD27_06025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like DAO Thi4 AlaDh_PNT_C K_oxygenase Glutaredoxin FAD_binding_3 NAD_binding_8 FMO-like Spermine_synth Methyltransf_34
Motif
Other DBs
NCBI-ProteinID: AMW78487
UniProt: A0A143G2T3
LinkDB All DBs
Position
complement(1298090..1299655)
Genome map
AA seq 521 aa AA seqDB search
MLDQNTSAQLKTLLERLESPIEIVATLNDSDKSKQIKELVEEVAALSALVTARFDGTNSR
APSFGIAKMGEQPRVNFAGLPMGHEFTSLILALLQVSGYAPKVSDEVLAQIKDLNIKADF
DVFVSLSCHNCPDVVQALNLIAINNPGTTATMIDGAFFQDEVEERKIMAVPMLFQDGEHI
GQGRMTLEEIIAKLDTNSAAKDAEKLNAKEAFDVLVIGGGPAGNTAAIYAARKGIKTGIV
AERMGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYGVDIMNLQRVKSIVGADQTTY
GNVEITLENGAKLESKTVILSTGARWREMNVPGEQEYKTRGVAYCPHCDGPLFKAKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLNSLPNTTVIKNALSTEVVGD
GKQVTALKYKDRATDEEHTVELAGIFVQIGLLPNTDFLKESDVELSNRGEIIINDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYMIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatacttccgcacaacttaaaacacttcttgaacgcttagaaagccct
atcgaaatcgtggcaaccttaaatgattctgataaatcaaagcaaattaaagaattggta
gaagaagtcgcagctttatctgcattggtgactgcacgtttcgacggtacaaatagccgc
gcaccaagttttggtatcgcgaaaatgggtgaacaacctcgtgttaatttcgcaggttta
cccatgggtcatgagttcacctcgttaatcttagcattgttacaagtatcaggttatgca
ccaaaagtctctgatgaagtcttggcgcaaattaaagatttgaatataaaagctgacttt
gatgtatttgtatcgttgagctgtcataactgcccagacgtggttcaagcactcaacttg
attgcaattaacaacccaggcacaacagcaaccatgattgatggtgcattcttccaagat
gaagttgaagaacgtaaaatcatggccgttccgatgttgttccaagacggtgagcatatt
ggtcaaggtcgtatgactttggaagaaatcattgccaagttagataccaactctgctgcg
aaagacgctgagaaattgaatgccaaagaagcctttgatgtattggtgattggtggtggt
cctgcagggaataccgcagccatctatgctgctcgtaaaggcatcaaaacagggatcgta
gctgagcgcatgggtggtcaagtcatggataccatggacattgaaaatttcacttcagtg
caaaaaacacaaggtcctaagtttgcagccgaaatggaagcacatgtacgtgagtacggt
gtcgacatcatgaacctgcaacgtgtgaaatcaattgtgggtgcagaccaaactacgtat
ggcaatgttgaaatcactttggaaaatggtgcaaaacttgaatcgaaaaccgtgatcctc
tctacaggtgcacgttggagagaaatgaatgtaccaggcgagcaagaatacaaaactcgt
ggtgttgcctactgcccgcattgtgacggcccactgtttaaagctaaacgtgttgcggtg
atcggtggtggtaactcaggtgtagaagcggcgattgatcttgcagggattgttgagcat
gtaacactggttgaatttgataccaaacttcgtgctgaccaagtgcttcaagacaaattg
aatagcttacccaacaccactgtgatcaaaaatgccttatcgacagaagtggtgggtgat
ggcaaacaagtaactgctttgaaatacaaagaccgtgcaactgatgaagaacatacggtt
gaacttgcagggatctttgtacagattggtttgttgcccaatacggatttcttgaaagaa
tcggatgttgaactgagtaaccgcggtgagatcatcattaatgatcgtaacgaaaccaat
gtcaaaggagtatttgctgcaggtgactgtaccactgtgccttataagcaaatcattatt
gccacaggtgaaggcgcaaaagcatcattgtctgcttttgattatatgatccgttcgggg
cagtaa

DBGET integrated database retrieval system