KEGG   Acinetobacter sp. TGL-Y2: AMD27_11195Help
Entry
AMD27_11195       CDS       T04425                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
acv  Acinetobacter sp. TGL-Y2
Brite
Enzymes [BR:acv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AMD27_11195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMW79401
UniProt: A0A143G5B7
LinkDB All DBs
Position
2354347..2354973
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYEDLAPHISKETLEFHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIITA
SAGDASKAGIFNNAAQVWNHTFYWNCMAKNGGGKATGPLAAKIDEAFGSYEKFAEEFAAA
ATTQFGSGWAWLVADQVNGNLSILKTSNADTPLAHGKVAVLTIDVWEHAYYIDFRNARPV
YIKTFLESLVNWDYANAKYAGQEAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgattactttaccagctctaccatacggttacgaagatcttgctccacatatc
agcaaagaaactttagaattccatcatgataagcaccacaatacttatgttgttaacctt
aacaacctcattaaaggaactgatcttgaaggcaaaactttagaagaaatcatcacagcg
tctgctggtgatgcctctaaagcaggtattttcaataatgctgcacaagtttggaaccac
acgttctactggaactgtatggctaaaaacggtggcggtaaagcgactggtcctttggct
gctaaaattgatgaagcattcggttcttacgaaaaatttgctgaagaatttgctgctgct
gcaaccactcagtttggttctggttgggcgtggttggttgctgatcaagttaacggcaac
ttatctattcttaaaacctcaaatgctgacacaccacttgcacatggcaaagttgcagta
ttaacgattgacgtttgggaacatgcttactacatcgatttccgtaatgcacgtcctgtt
tatatcaaaactttcctagaaagccttgtaaactgggattacgcgaacgcgaaatatgca
ggtcaagaagctggtgtagagaaataa

DBGET integrated database retrieval system