KEGG   Acinetobacter sp. TGL-Y2: AMD27_13775Help
Entry
AMD27_13775       CDS       T04425                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
acv  Acinetobacter sp. TGL-Y2
Pathway
acv00020  Citrate cycle (TCA cycle)
acv00270  Cysteine and methionine metabolism
acv00620  Pyruvate metabolism
acv00630  Glyoxylate and dicarboxylate metabolism
acv00680  Methane metabolism
acv01100  Metabolic pathways
acv01110  Biosynthesis of secondary metabolites
acv01120  Microbial metabolism in diverse environments
acv01130  Biosynthesis of antibiotics
acv01200  Carbon metabolism
Module
acv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acv_M00012  Glyoxylate cycle
acv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:acv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMD27_13775
   00620 Pyruvate metabolism
    AMD27_13775
   00630 Glyoxylate and dicarboxylate metabolism
    AMD27_13775
  09102 Energy metabolism
   00680 Methane metabolism
    AMD27_13775
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AMD27_13775
Enzymes [BR:acv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AMD27_13775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AMW79855
UniProt: A0A143G6S0
LinkDB All DBs
Position
complement(2879193..2880179)
Genome map
AA seq 328 aa AA seqDB search
MKQAVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEVPFEKAQQALKGVMMELQ
DCAFPLLEGMVGTDDPKVAFKDADYALLVGSRPRGPGMERADLLKVNGEIFIGQGQALNE
VASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHNRAASQIAAKTGKAVKDI
KTLTVWGNHSPTMYADYRFATINGENVKDMINDQEWNANTFLPTVGKRGAAIIEARGLSS
AASAANAAIDHMRDWALGTNGEWVTMGIPSDGSYGIPEGVMFGFPVTTENGEYKIVQGLE
IDQFSRERINVTLNELEEERAAIADMLK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagccgttcgtgttgccgttacaggtgctgcaggtcaaattggttacagctta
cttttccgtatcgcaagtggcgaaatgttaggtaaagatcaacccgttattttgcaattg
ctcgaagttccatttgagaaagctcaacaagcgcttaaaggcgtgatgatggagcttcaa
gactgcgcattccctcttttagagggtatggtaggtactgatgatcctaaagttgcattt
aaagatgctgactatgcgttgttggttggttcgcgtccacgtggtccaggtatggaacgt
gctgacttattgaaagtgaacggtgaaatcttcatcggtcaaggtcaagcattaaatgaa
gttgcgagccgtgacgttaaagttcttgtcgtaggtaaccctgcaaacacgaatgcttac
atcgcaatgaaatctgctccagatcttccagcgaaaaacttcactgcgatgttacgtctt
gaccacaaccgtgctgcatctcaaattgcggctaaaacgggtaaagcagttaaagacatc
aaaacacttacagtttggggtaaccactctccaaccatgtatgcagactaccgttttgca
accattaatggtgaaaacgtaaaagacatgattaacgatcaagaatggaatgcaaacaca
ttccttccgactgtgggtaaacgtggtgctgcgattattgaagcacgtggtttgtcttca
gctgcatctgctgcgaacgctgcaattgatcatatgcgcgattgggctcttggcaccaat
ggcgaatgggtaacgatgggtattccttctgacggctcttacggtattcctgaaggcgtg
atgttcggtttccctgtaacgactgaaaacggtgaatacaaaatcgttcaaggtcttgaa
atcgaccaatttagccgtgagcgtatcaacgtaacgttgaatgaacttgaagaagagcgc
gcagcaattgctgacatgcttaaataa

DBGET integrated database retrieval system