KEGG   Acinetobacter sp. TGL-Y2: AMD27_15320Help
Entry
AMD27_15320       CDS       T04425                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
acv  Acinetobacter sp. TGL-Y2
Pathway
acv00473  D-Alanine metabolism
acv00550  Peptidoglycan biosynthesis
acv01100  Metabolic pathways
acv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMD27_15320
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMD27_15320
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AMD27_15320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acv01011]
    AMD27_15320
Enzymes [BR:acv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AMD27_15320
Peptidoglycan biosynthesis and degradation proteins [BR:acv01011]
 Precursor biosynthesis
  Amino acid ligase
   AMD27_15320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AMW80132
UniProt: A0A143G7D8
LinkDB All DBs
Position
complement(3206765..3207694)
Genome map
AA seq 309 aa AA seqDB search
MSNASKFGKVAVLLGGKSAEREVSLDSGKAVLEALIRSGVNAEGFDPQERSVTELINYDR
AFIVLHGRGGEDGQIQGVLEWLNVPYTGTGVQGSAIGMDKVKTKQIWQGSGLPTAPHRIV
SQDTNLDEVIASLGLPLIIKPVHEGSSVGMSKVEKAEDLASAIAKAVQHDAVVMAEQWIT
GREYTISFLNGQPLPVIRLQPPADVAFYDYDAKYMRNDVEYGIPSGLSDHDEKQLQDLCL
RAFQAVGACGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAANAVGYSFDQLCIAIL
EQTLSKETH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaatgcttctaaattcggcaaagttgctgtattgcttggtggtaaatctgcagag
cgtgaggtttcattagatagtggaaaggctgtacttgaagcattgattcgttcaggtgtg
aatgcagaaggatttgatccgcaagagcgcagtgtgactgaacttataaattacgatcgc
gcatttattgttttgcatggtcgtggcggtgaagacggtcagattcaaggcgtattagag
tggttgaatgtaccgtatactggtactggtgttcaaggttctgccattggtatggataaa
gtcaaaaccaagcaaatttggcaaggttcaggattgcctacagcaccacatcgaattgtt
tcacaagacaccaatttagacgaagtcattgcgagcttgggtttacctttaatcattaag
ccagtacacgaaggttcaagtgtcggtatgagtaaggttgaaaaagcagaagatttagcc
agtgcaattgccaaagcggttcagcatgatgctgtggttatggcagaacagtggattaca
gggcgtgaatacacgatttcgttcttaaatggtcaaccacttccagtgattcgtttacaa
ccccctgcggatgttgcattttacgattatgacgctaaatatatgcggaatgatgtcgaa
tacggcattccatctggcttgtcggatcatgatgaaaagcagcttcaggatctgtgctta
cgtgcatttcaagcggtgggtgcatgtggttggggacgtattgatgccatgcaagatgag
caaggtaatttctggctactcgaagtcaatactgtacccgggatgaccagtcattcgttg
gtgcctaaagcggccaatgcggtaggttatagttttgatcagctatgtatcgcgattctt
gaacaaacgcttagcaaagaaacgcactaa

DBGET integrated database retrieval system