KEGG   Acinetobacter sp. DUT-2: A0J50_10145Help
Entry
A0J50_10145       CDS       T04353                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acw  Acinetobacter sp. DUT-2
Brite
KEGG Orthology (KO) [BR:acw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A0J50_10145
Enzymes [BR:acw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A0J50_10145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 Thi4 AlaDh_PNT_C NAD_binding_8 K_oxygenase Cytochrom_C_2 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AMO40974
UniProt: A0A127KGU7
LinkDB All DBs
Position
complement(2160818..2162383)
Genome map
AA seq 521 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVTEIAELSDKVTARFDGNNTR
RPSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDEVLNQIKGLNLKANF
DVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGSFFQDEVEQRKIMAVPMVFQDNEHI
GQGRMTLEEIVAKLDTNSAEKDAAALNAKDAFDVLVIGGGPAGATAAIYAARKGINTGIV
AERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKITGANQTAN
GLVEVELENGAKLESKTVILSTGARWREMNVPGEQEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLHSLPNTTVIMNALSTEVLGD
GSQVTGLKYKDRATDEEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIVNDRNETN
VQGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaacattaaaactcaattaaaagcttacttagaacgtctagaaagtcca
atcgaattagttgctgccttagatgaatcagataaagctgctcaaattaaagaattagtg
acagaaattgctgagctttctgacaaggtgactgcccgttttgacggtaataatacacgt
cgtccaagctttggtgtggctaaagcaggtgaacaacctcgtgtattcttcgcaggctta
ccaatgggtcatgagtttacgtctttgatcttggctctgttacaagtgtctggctatgca
cctaaagtgtcggatgaagttttaaatcaaattaaaggcttaaacctcaaagctaacttt
gatgtgtttgtatcattaagctgtcataactgtccggatgtggtacaggcgcttaacctg
attgccatttataacccgaacactacagcaaccatgattgatggttcattcttccaagat
gaagtggaacaacgcaaaatcatggctgtgccaatggtgttccaagacaacgaacacatt
ggccaaggtcgtatgacccttgaagagattgtagcgaaactcgacactaactcagctgaa
aaagatgcagcagcactcaatgctaaagatgcatttgatgtgttggtgattggtggtggt
cctgcgggtgcaacggctgcgatctatgctgcacgtaaaggcattaacactggtatcgtg
gctgaacgcttcggtggtcaagtgatggacaccatggacattgaaaacttcacttctgtg
caaaagacgcaaggtcctaagtttgctgccgagatggaagcccatgttcgtgaatatgat
gtcgatatcatgaacctgcaacgtgtcagcaaaatcacgggtgccaaccagactgcaaat
ggcttggttgaagttgaacttgaaaacggtgcaaaacttgaatcgaaaactgtaatcctt
tctacaggtgcacgttggagagaaatgaatgtaccgggtgagcaagaataccgtacccgt
ggtgttgcctactgcccacactgtgatggcccattgttcaaaggcaaacgtgttgccgtg
attggtggtggtaactcaggtgttgaagcagcaattgaccttgcagggattgttgagcat
gtcactctggttgagtttgacaccaagcttcgtgctgaccaagtgttgcaaaacaaattg
catagcttgccaaacacaacggtgattatgaatgccttaagtacagaagtgttaggtgat
ggttcacaagtgactggtcttaaatataaagaccgtgcgactgatgaagagcatgtagtc
gagcttgcagggatctttgtacagattggtttattgccaaacactgacttcttgaaagac
agtgaagttgaattaaccaaccgtggcgagatcattgtcaatgaccgcaacgaaaccaat
gtacaaggtgtatttgcggcgggtgactgtacgactgtaccttacaagcaaatcattatt
gctacaggtgaaggtgctaaagcatcactctcagcgtttgattacatcatccgttctggg
cagtaa

DBGET integrated database retrieval system