KEGG   Acinetobacter sp. DUT-2: A0J50_10810Help
Entry
A0J50_10810       CDS       T04353                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
acw  Acinetobacter sp. DUT-2
Pathway
acw00473  D-Alanine metabolism
acw01100  Metabolic pathways
acw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0J50_10810
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A0J50_10810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acw01011]
    A0J50_10810
Enzymes [BR:acw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A0J50_10810
Peptidoglycan biosynthesis and degradation proteins [BR:acw01011]
 Precursor biosynthesis
  Racemase
   A0J50_10810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMO41087
UniProt: A0A127KGT8
LinkDB All DBs
Position
2304763..2306055
Genome map
AA seq 430 aa AA seqDB search
MKLKTKFSHLAYSCALILFGSVQFAHAAPLLTPHVTNEVSPAPTANAWIEIDTQAFEDNI
KRTNQLLNGKTQLCIVMKANAYGHSIDLLMPSVMKLNVSCIGITSNAEAAMVRKHGYKGK
ITRLRTATDSEIINAQVLNIEELLGNYDQAARMSKWAEANNTTVHYSLALNSGGMDRNGL
EMATALGKEQAVAITKLPHLKIDGIMTHYAVEDEKFVRERLAQFNEQIAWLIKKAKLNRK
ELTLHTANSFATVNVPESHLDMVRAGAIIYGDFPNHPEFKGMMAFKTQIAAVNNYLKDST
VGYDQTYTLKRDSRLANLPVGYSDGYRRSFSNKAFVLINGQKAPVVGRVSMNTVMVDVTD
IPEAKAGDEVVLFGHQGNAEVKTSDLTSLTGHILTEAYIPWSNSNPQVIKPLQSQQQVIL
TNNKVAAKAN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaaacaaaattttctcatctcgcttatagctgtgcattaatattattcggt
tcggtgcaatttgctcatgcagctcccttacttactccccatgttacaaatgaagtaagc
cctgcacctacagcaaatgcatggatagaaattgatactcaagcttttgaagataatatt
aaaaggacaaatcagttacttaatggcaaaactcaactttgtatagtcatgaaagctaac
gcatacggccatagtattgatctacttatgccaagtgttatgaagttaaacgtatcttgt
attggcattaccagtaatgctgaagcggctatggtgcgtaagcatggctataaaggcaaa
attacacgtttacgtaccgccacagatagtgaaattatcaatgcacaggtgttaaatatt
gaagagcttttaggtaattatgaccaagctgctcgtatgtctaaatgggcagaagcgaac
aatacaactgttcattacagcttggctttaaattcaggcggtatggatcgtaatggtctt
gaaatggctacggctctaggcaaagaacaagctgttgcgatcaccaaacttccacatctt
aaaattgacggcattatgacccactatgcagtagaagatgaaaaatttgtccgtgagcgt
ctggcgcaatttaatgaacaaatcgcatggttgattaaaaaagccaaactgaatcgtaaa
gaattaacattacataccgctaattcatttgctactgtaaatgttcctgaatcacattta
gatatggttcgtgcaggcgcaattatatatggggattttcctaatcaccctgaatttaaa
ggtatgatggcatttaaaacacaaattgccgcagtgaataattacctgaaagattcaact
gtaggttatgaccaaacctatactttgaaacgtgactctagactcgcaaacctccctgta
ggttattcggatggctaccgtcgtagttttagtaataaagcttttgtattaatcaatgga
caaaaagcgccagtggttggtcgagtctcaatgaatacagttatggttgatgtaacagat
attccagaggcaaaagcaggtgatgaagttgtattatttggtcatcaaggcaatgcggaa
gttaaaacgagtgatttaaccagccttacaggccatattttgacagaagcctatatccct
tggagtaactctaatccacaagtgattaaaccccttcaatctcagcaacaagtgatatta
accaataataaagttgcggcaaaggccaactaa

DBGET integrated database retrieval system