KEGG   Acinetobacter sp. DUT-2: A0J50_12335Help
Entry
A0J50_12335       CDS       T04353                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
acw  Acinetobacter sp. DUT-2
Pathway
acw00550  Peptidoglycan biosynthesis
acw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:acw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0J50_12335
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A0J50_12335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acw01011]
    A0J50_12335
Enzymes [BR:acw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A0J50_12335
Peptidoglycan biosynthesis and degradation proteins [BR:acw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A0J50_12335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Stimulus_sens_1
Motif
Other DBs
NCBI-ProteinID: AMO41351
UniProt: A0A127KH42
LinkDB All DBs
Position
2623161..2625179
Genome map
AA seq 672 aa AA seqDB search
MKQHFPLKDIQQEKRIYRGRIFFAVGIVTICLLVLISRYAYLQIFHYDEFSTASDKNRIR
LQPLPPARGYIYDRNGVLLADNYPVFTATLSKTDVEDVDSVIEQLQPILDLTQEDIDRFK
SRIKTARKTERVAIKLNLTEANIAKFSEAKYKFPGVRIETQMTRYYPHGELFAHVIGYVG
RINDKELKSIDKDLYAGTNLIGKIGVEKSYEDLLHGTPGYESVEADAHSNVLRHLGRKDP
TRGNDLYLSLDYGLQVVASQQLAGRRGAIVAIDPRTGEILALVSSPSFNPNLFVTGISHT
DYSSLRDNLDQPLYNRAVQGVYPPGSTIKPMEAMGGLHYSIVDWSTAISDPGYFHLPGDS
HKFRDWKKSGHGIVNMHKAIVQSCDTYFYILAHQMGIDQMNQWMRQFGFGQKTGVDLPSE
SEGLYPSPEWKMRTRKAKWMKGETISVSIGQGAFTATPLQLAMATAITANHGSHVTPHVL
RATHGAKPFTVRNAPDGKIKFNGTDEDWIQMRDAMIDVIQSGTGRGIRTPLYQIAGKTGT
AQVKSIAQGKRYNEAALSERQLDHGLFVGFAPAEKPEIAIAVIWENGRHGGSAAQLARPV
FDYWLLTRKKNPIRPANHQVNGGLMTAGIKPGELPSGGESSGPASATATTNKPAASTPQA
APARPATNEADE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcactttcctttaaaagatatccagcaagaaaagcgcatttatcgaggtcgt
atcttttttgccgtagggatcgtgaccatctgcttattagttttaattagccgatacgct
tatctacaaatttttcactacgacgaattctcgactgcatctgacaaaaaccgaattcgc
ttgcaaccacttccacctgctcgtggttatatctatgacagaaacggtgtattactagca
gataactatcctgtttttacagcaactttaagtaaaacagatgtagaagatgttgatagt
gtcatcgagcaattacagcctattttagatttaacgcaagaagatattgaccgttttaaa
agccgtataaaaactgcccgtaaaactgaacgcgtcgcgattaaacttaatctaactgaa
gccaatattgctaaatttagtgaagccaaatataagtttccgggtgtaagaatcgagaca
caaatgactcgctattatccacacggtgagttatttgctcatgtgattggctatgtcggg
cgtatcaacgataaagaattaaaaagtattgataaagacttatatgctgggaccaaccta
attggaaaaattggcgttgagaaaagctatgaagacctattgcacggaacacccggttat
gaatctgttgaagcagatgcacatagtaatgtattgcgtcatttaggtcgtaaagaccct
actcgcggtaatgacctctatttatctttagattacggtttacaagttgtcgcttctcag
cagctcgcaggtcgtcgtggagctattgtcgctattgatcctcgtacaggtgaaattcta
gctttagtgtctagtccaagttttaaccctaatttgtttgtgactggaattagtcatact
gactacagctcactacgcgataatttagaccaacctctttataaccgtgctgtgcagggt
gtatatccacctggttctaccattaaaccaatggaagcaatgggtggcctacactacagt
attgtagactggtcaacagcaatttctgatcctggttatttccatctacctggtgattca
cataagttccgtgactggaagaaatctggtcatggcatcgtgaatatgcataaagcgatt
gtgcaatcctgtgatacctatttttatattcttgcccatcaaatgggtattgatcaaatg
aaccaatggatgcgccaatttggatttggtcaaaaaacaggtgtcgatttaccaagtgaa
agtgaaggcctttatccaagtcccgaatggaaaatgcgtacgcgtaaagcgaaatggatg
aagggtgaaactatttctgtcagtattggtcaaggcgcgtttacagccactccattacag
cttgcgatggcaacagcaattacggcaaatcatggttctcatgtaacgcctcatgtttta
cgcgcaacgcatggtgcaaaaccatttacagtacgtaatgcacctgatggcaaaatcaaa
ttcaacggcacggatgaagactggattcaaatgcgtgatgccatgattgatgtaattcaa
tcaggtactggccgcggtattcgtactcccctctaccaaattgcagggaaaacaggtaca
gcacaggttaagagtattgcacagggtaaacgctataacgaagcagccttgagtgaacgt
caacttgaccatggtttattcgttggatttgcccctgctgaaaaacctgaaattgcgatt
gcagtcatttgggaaaatggtcgtcatggtggttcagctgctcaacttgcaagacctgtc
tttgattactggctattaactcgtaagaaaaacccgattcgtccagcaaatcaccaagtc
aatggcgggctaatgacagcaggaattaaaccaggtgaacttccaagcggcggtgaaagt
tctggtcctgcatcggctacagccaccaccaacaaaccagcagcatcaacaccgcaagct
gctcctgctcgtcctgctaccaatgaggccgatgaataa

DBGET integrated database retrieval system