KEGG   Acinetobacter sp. DUT-2: A0J50_14910Help
Entry
A0J50_14910       CDS       T04353                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
acw  Acinetobacter sp. DUT-2
Pathway
acw00061  Fatty acid biosynthesis
acw00780  Biotin metabolism
acw01100  Metabolic pathways
acw01130  Biosynthesis of antibiotics
acw01212  Fatty acid metabolism
Module
acw_M00083  Fatty acid biosynthesis, elongation
acw_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:acw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A0J50_14910
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A0J50_14910
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A0J50_14910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acw01004]
    A0J50_14910
Enzymes [BR:acw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     A0J50_14910
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     A0J50_14910
Lipid biosynthesis proteins [BR:acw01004]
 Fatty acid synthase
  Component type
   A0J50_14910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AMO42414
UniProt: A0A127KKH5
LinkDB All DBs
Position
complement(3179383..3180186)
Genome map
AA seq 267 aa AA seqDB search
MTQGLLAGKRFLIAGVASKLSIAFGIAQALHREGAELAFTYPNEKLKKRVDEFAEQFGSK
LVFPCDVAVDAEIDNAFAELAKHWDGVDGVVHSIGFAPAHTLDGDFTDVTDREGFKVAHD
ISAYSFVAMARAAKPLLQARQGCLLTLTYQGSERVMPNYNVMGMAKASLEAGVRYLASSL
GVDGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAPLKRNVTIEEVGNAALFLCSPWA
SGITGEILYVDAGFNTVGMSQSMMDDE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaggacttttagcaggtaagcgctttttgattgcaggcgttgctagtaaatta
tcaattgcttttggtattgcccaagcattacaccgtgaaggtgcagagcttgcgtttact
tatccaaacgaaaaattaaaaaaacgtgtggatgaatttgctgagcaattcggttctaag
cttgtgtttccatgtgatgttgctgttgatgctgaaattgataatgcatttgcagaactt
gcaaaacattgggatggtgtagacggtgttgtacactcaattggcttcgcacctgcacat
acacttgatggtgattttactgacgtgactgaccgtgaaggttttaaagttgctcatgac
atcagtgcatacagctttgttgcaatggcacgtgctgcaaaacctctcttacaagctcgc
caaggttgtttattgactttgacttaccaaggttctgagcgcgttatgcctaactataac
gttatgggtatggcaaaagcttctttagaagctggtgttcgttacttggcatcaagcctt
ggtgttgatggtattcgtgtaaacgcgatttctgcgggcccaatccgtactttagctgct
tctggtattaaatctttccgtaaaatgttagatgccaatgaaaaagttgcgccattaaaa
cgtaacgtaaccattgaagaagtaggtaacgcagcattattcctatgctcaccttgggct
tcgggtattactggtgaaattctatatgtagatgctggtttcaatactgtaggtatgagc
caatctatgatggatgatgaataa

DBGET integrated database retrieval system