KEGG   Azotobacter chroococcum: Achr_18060Help
Entry
Achr_18060        CDS       T03640                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
acx  Azotobacter chroococcum
Pathway
acx00020  Citrate cycle (TCA cycle)
acx00190  Oxidative phosphorylation
acx00650  Butanoate metabolism
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01120  Microbial metabolism in diverse environments
acx01130  Biosynthesis of antibiotics
acx01200  Carbon metabolism
Module
acx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Achr_18060 (sdhA)
   00650 Butanoate metabolism
    Achr_18060 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Achr_18060 (sdhA)
Enzymes [BR:acx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Achr_18060 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Achr_18060 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AJE21262
UniProt: A0A0C4WSI9
LinkDB All DBs
Position
1981232..1983004
Genome map
AA seq 590 aa AA seqDB search
MANIRTLSFDAIIVGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTETGRIYQRP
FGGQSKDYGNGGQAARTCAAADRTGHALLHTLYQGNLKNNTTFLNEWYAVDLVKNQDGAV
VGIIAICIETGETVYIRCKAVVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKHGERFMERYAPNAKDLAGRDVVARSMVKEI
IAGNGCGPDGDHVLLKLDHLGEEVLHSRLPGICELSKTFAHVDPVTAPVPVVPTCHYMMG
GVATNIHGQAITQDANGNDKIIEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALKEGIEYRGASESDLDESLKRLSGVNERSSGEEVAPLRKELQNCMQNYFGVFRTGE
YMQKGIAQLAELRERVAQVKINDKSQAFNTDRIEALELQNLLEVAEATAIAAETRKESRG
AHAREDFEERDDKEWLCHTLYFPGEKRVAKRAVNFAPKTVPAFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctaacattcgtacgctttccttcgacgcaatcatcgtcggcggtggtggtgctggc
atgcgtgctgccctgcaactggctcagggtggtcacaagactgcagtagtcaccaaggta
tttccgacccgttcgcacaccgtgtccgcccagggcggcatcacctgcgccatcgcctcg
gccgacccgaacgacgattggcgctggcacatgtacgacaccgtcaagggctccgactac
atcggtgaccaggacgccatcgaatacatgtgctcggtcggtcccgaagccgtattcgaa
ctcgagcacatggggctgccgttctcccgtaccgaaaccggccgcatctatcagcgtccg
ttcggtggccagtccaaggactacggcaacggcggccaggcggcccgtacctgcgcggct
gccgaccgtaccggtcacgcgctgctgcacaccctgtatcagggcaacctgaagaacaac
accactttcctcaacgagtggtacgcggtcgatctggtgaagaaccaggatggcgccgtg
gtcggcatcatcgccatctgcatcgaaaccggcgaaaccgtctacattcgctgcaaggcc
gtggttctggccaccggcggtgccggtcgcatctacgcctcgaccaccaacgccctgatc
aacaccggtgacggcgtgggcatggccctgcgtgccggcgtgccggtgcaggacatcgag
atgtggcagttccacccgaccggcatcgccggtgccggcgtgctggtgaccgagggttgc
cgcggcgagggcggctacctgatcaacaagcacggcgagcgcttcatggagcgttatgct
ccgaacgccaaggacctggccggccgcgacgtggtggcgcgctccatggtcaaggaaatc
atcgccggcaacggctgtggtccggatggcgaccatgtgctgctgaaactcgaccacctc
ggcgaggaagtactgcacagccgtctgcccggcatctgcgaactgtccaagactttcgcc
catgtcgacccggtgaccgctccggttccggtcgtgccgacctgccactacatgatgggt
ggcgtggccaccaacatccatggtcaggccatcacccaggacgccaacggcaacgacaag
atcatcgaaggcctgttcgccgtgggcgaagtggcatgcgtatccgtacacggcgccaac
cgcctgggcggcaactcgctgctcgacctggttgtgttcggccgcgccgccggtctgcac
ctggagaaggcgctcaaggaaggcatcgaataccgcggtgcttccgagtccgacctcgac
gagtcgctcaagcgcctgtccggcgtgaacgagcgcagcagcggcgaagaagtcgctccc
ctgcgcaaagagctgcagaactgcatgcagaactacttcggcgtgttccgtaccggcgaa
tacatgcagaagggtatcgcccagctggccgaactgcgcgagcgcgtcgctcaggtcaag
atcaacgacaagagccaggcgttcaacaccgaccgcatcgaggcgctcgagctgcagaac
ctgctcgaagtggccgaggccaccgcgatcgctgcggaaacccgcaaggagtcccgtggt
gcccacgcccgtgaggacttcgaggagcgtgacgacaaggaatggctgtgccacaccctg
tatttcccgggtgagaagcgcgtggccaagcgtgccgtcaacttcgcgccgaagaccgtt
ccggcgtttgaacccaaagtgcgtacctattaa

DBGET integrated database retrieval system