KEGG   Azotobacter chroococcum: Achr_18070Help
Entry
Achr_18070        CDS       T03640                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
acx  Azotobacter chroococcum
Pathway
acx00020  Citrate cycle (TCA cycle)
acx00190  Oxidative phosphorylation
acx00650  Butanoate metabolism
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01120  Microbial metabolism in diverse environments
acx01130  Biosynthesis of antibiotics
acx01200  Carbon metabolism
Module
acx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Achr_18070 (sdhB)
   00650 Butanoate metabolism
    Achr_18070 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Achr_18070 (sdhB)
Enzymes [BR:acx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Achr_18070 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Achr_18070 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AJE21263
UniProt: A0A0C4WHT3
LinkDB All DBs
Position
1983016..1983735
Genome map
AA seq 239 aa AA seqDB search
MSLPKTLQVSVYRYNPEQDSAPYMQNLNVDIDGKDLMVLDVLALIKEGDSSFSYRRSCRE
GVCGSDGMNMNGKNGLACITPLSSTVTDGKLVIRPLPGLPIIRDLVVDMSIFYKQYEKVQ
PYLQNNTPAPAIERLQSPEEREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAY
RFLADSRDTKTQERLAAMDDPFSVFRCRGIMNCVYVCPKGLNPTKAIGHVRDMLLRSGT
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcccaagacattgcaagttagcgtttatcgctacaatccggagcaggactct
gctccctacatgcagaatctgaacgtcgacatcgatggcaaggacctgatggttctcgat
gtcctggccctgatcaaagagggtgacagcagcttctcctaccgtcgctcctgccgtgaa
ggcgtctgcggttccgacggcatgaacatgaacggcaagaacggcctggcctgcatcacc
ccgctgtccagcacggtgaccgacggcaagctggtgattcgcccgctgcccggcctgccg
atcatccgcgacctggtcgtggacatgagcatcttctacaagcagtacgagaaggtgcag
ccctacctgcagaacaatactcccgccccggccatcgagcgtctgcagagcccggaagag
cgcgagaagctggacggtctctacgagtgcatcctgtgcgcttgctgctcgacctcctgt
ccgtccttctggtggaacccggacaagttcctcggtcccgctgcactgctgcaggcctat
cgcttcctggccgacagccgtgacaccaagacccaggagcgtctggctgccatggatgac
ccgttcagcgtattccgttgccgcggcatcatgaactgcgtgtatgtctgcccgaaaggc
ctgaacccgaccaaggccatcggtcacgtgcgcgacatgctgctgcgtagcggtacctga

DBGET integrated database retrieval system