KEGG   Azotobacter chroococcum: Achr_19660Help
Entry
Achr_19660        CDS       T03640                                 

Gene name
treS
Definition
(GenBank) Trehalose synthase, maltokinase fusion protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
acx  Azotobacter chroococcum
Pathway
acx00500  Starch and sucrose metabolism
acx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Achr_19660 (treS)
Enzymes [BR:acx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Achr_19660 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Achr_19660 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AJE21421
UniProt: A0A0C4WM82
LinkDB All DBs
Position
2184810..2188136
Genome map
AA seq 1108 aa AA seqDB search
MDQLSKPAAFLEDPLWYKDAVIYQVHVKSFFDSNNDGIGDFPGLIAKLDYIADLGVNTLW
LLPFYPSPRRDDGYDIAEYRGVHPDYGSLADVRRFIAEAHRRGLRVITELVINHTSDQHP
WFQRARKARKGSAARNFYVWSDSDDKYPDTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLGIMRYWLDLGVDGLRLDAIPYLIERDGTNNENLPETHQVLKRIRA
ELDADYPDRMLLAEANQWPEDTQLYFGGTPEGRGDECHMAFHFPLMPRMYMAIAQEDRFP
MTDILRQTPDIPTDCQWAVFLRNHDELTLEMVTDRERDYLWNFYAADRRARINLGIRRRL
APLLERDRRRIELLNSLLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPAGLVLPPIMDPLYGFQTVNVEAQQRDSYSLLNWTRRMLAVRRQQKAFGRGTLKL
LAPANRRIFAYLREYHGADGSETILCVANVSRSAQAVELELPQFTGMVPVEMTGGSAFPP
IGQLPYLLTLPPYGFCWFLLAPESQMPSWHIKPAEGMPEFQTLVLRRLDDLLVDPNRRIL
EKEVLPAYLPKRRWFAGKGAPLGNVRIIYTVTFGNLPRPVLLSEIESGVEGNLQRYQLPL
GFLPEEEFGSVLPQQLAMARVRRGRRVGLLTDAFTLEGFVRAVIQALRERRVLAFEQGEL
RFLPTAQLDPIELPADAEVRYISAEQSNSSVVIGNALVLKLIRRVSPGVHPELEMGLFLT
RCGFANIASVLGEVCRIDGLGECTALMILQRYLENQGDAWEWTQNTLDRAIRDELAGGES
TLESQYSALHELENFSRQFGQRLGEMHMALAGPTDNRDFAPETAGPADVAHWAEGVGAQL
ERALVILAERQATLDEEARVAAGQLLLQRDALRAKIGQLAEACVGSLRIRVHGDLHLGQV
LVVQGDAYLIDFEGEPSRPLAERRARHSPYKDVSGVLRSIGYAAEMAMRNAQSIDSSEAA
DQARQRIASLYQDKARQAFLAAYRQAAADIGHAWAAPGGEEAALALFSLEKTLYEIAYEA
EHRPAWLAVPLRGLVSLAQQLLDGDALR
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggatcaattgtccaagcctgccgccttcctcgaagacccgctctggtacaaggacgcg
gtgatctaccaggtgcacgtcaagtcgttcttcgactccaacaacgacggcatcggcgac
tttcccgggctgatcgccaagctggactacatcgccgacctgggcgtcaacaccctctgg
ctgctgccgttctatccctcgccgcgccgcgacgacggctacgacatcgccgaataccgc
ggcgtgcatcccgactacggcagtctcgccgatgtgcgccgcttcatcgccgaggcgcac
cggcgcgggctgcgggtgatcaccgagctggtgatcaaccacacttccgaccagcatccc
tggttccagcgcgcgcgcaaggccaggaagggctcggcggcgcgcaacttctatgtctgg
tcggacagcgacgacaagtacccggacacccggatcatcttcctcgacaccgagaagtcc
aactggacctgggacccggtcgccggccagtacttctggcaccgcttctactcgcaccag
ccggacctcaacttcgacaacccgcaagtgatgaaggcggtgctcggcatcatgcgctac
tggctcgacctgggcgtcgatggcctgcgcctggacgccattccctacctgatcgagcgc
gacggcaccaacaacgagaacctccccgagacccaccaggtgctcaagcgcatccgcgcc
gagctggatgccgactacccggaccgcatgctgctggccgaggccaaccagtggccggag
gacacccagctgtacttcggcggcaccccggagggccggggcgacgaatgccacatggcc
ttccacttcccgctgatgccgcgcatgtacatggccatcgcccaggaagaccgcttcccg
atgaccgacatcctgcgccagacgccggacatcccgaccgactgccagtgggcggtcttc
ctgcgcaaccacgacgagctgaccctggagatggtcaccgaccgcgagcgcgactacctg
tggaacttctacgccgccgaccgccgcgcgcggatcaacctcggcatccgccggcgcctg
gcgccgctgctggagcgcgaccggcggcgcatcgagctgctcaacagcctcttgctgtcg
atgccgggcaccccggtgatctactacggcgacgagatcggcatgggcgacaatatctac
ctgggcgaccgcgacggggtgcgcacgcccatgcagtggagcatcgaccgcaacggcggc
ttctcccgcgccgatccggccggcctggtgctgccgccgatcatggacccgctgtacggc
ttccagaccgtgaatgtcgaggcccagcagcgcgacagctattcgctgctcaactggacc
cggcgcatgctcgccgtgcgcaggcagcagaaggccttcggccgcggcacgctgaagctg
ctggcgccggccaaccggcgcatcttcgcctacctgcgcgaataccatggggcggacggc
agcgagaccatcctctgcgtggccaacgtctcgcgctcggcccaggcggtggagctggag
ctgccgcagttcaccggcatggtgccggtggagatgaccggcggcagcgccttcccgccg
atcggccagctgccctacctgctgaccctgccgccgtacggtttctgctggttcctgctg
gcgcccgagtcgcagatgcccagctggcacatcaagccggccgagggcatgcccgaattc
cagaccctggtgctgcgccgtctcgacgacctgctggtggaccccaaccggcgcatcctg
gagaaggaagtgctgccggcctacctgcccaagcgccgctggttcgccggcaagggcgcg
ccgctgggcaacgtgcgcatcatctatacggtgaccttcggcaatctgccgcgccccgtg
ctgctcagcgagatcgagagcggcgtcgagggcaacctgcagcgctaccagctgccgctg
ggctttctccccgaggaggagttcggcagcgtcctgccccagcagctggccatggcccgg
gtgcgccgcggccggcgggtgggcctgttgaccgatgccttcaccctggagggcttcgtt
cgtgcggtgatccaggcgctgcgcgagcgccgcgtgctggccttcgagcagggcgagctg
cgcttcctgcccaccgcccagctcgacccgatcgagctgccggccgacgccgaggtgcgc
tacatctccgccgagcagtccaacagctcggtggtgatcggcaatgccctggtactcaag
ctgatccgccgggtttcgccgggcgtgcaccccgagctggagatgggcctgttcctcacc
cgttgcggcttcgccaacatcgccagcgtgctcggcgaggtgtgccggatcgatggcttg
ggtgaatgcaccgcgctgatgatcctgcagcgctacctggagaaccagggcgatgcctgg
gagtggacgcagaacaccctcgaccgcgccatccgcgacgaactggccggcggcgagtcg
accctggagagccagtacagtgcgctgcacgaactggagaacttttcccgccagttcggc
cagcgcctcggcgagatgcacatggccctggccgggcctaccgacaaccgggatttcgct
cccgaaactgccggccccgcggacgttgcgcactgggccgagggcgtcggcgcccagctg
gaacgggccctggtgattcttgccgagcgccaggcgacgctggacgaagaggcacgtgtc
gccgccgggcagctgttgctgcagcgcgacgccctgcgggcgaagatcggccagctggcc
gaggcctgcgtcggcagcctgcgtatccgcgtgcacggcgacctgcacctcggccaggtg
ctggtggtgcagggcgatgcctatctgatcgatttcgagggcgaaccgtcgcggccgctc
gccgagcgccgcgccaggcacagcccctacaaggacgtcagcggcgtgctgcgctcgatc
ggctacgctgccgaaatggccatgcgcaacgcgcagagcatcgacagctcggaggcggcc
gaccaggcccgccagcgcatcgcctcgctgtaccaggacaaggcccgccaggccttcctc
gccgcctatcgccaggccgcggccgacatcggtcatgcctgggccgcgccgggcggcgaa
gaggccgccctggcgctgttcagcctggagaagacgctctacgaaatcgcctatgaagcc
gaacaccgacctgcctggctggccgtgccgctgcggggtctggtgagcctggcgcaacag
ctactggatggagatgcattgcgatga

DBGET integrated database retrieval system