KEGG   Azotobacter chroococcum: Achr_21630Help
Entry
Achr_21630        CDS       T03640                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acx  Azotobacter chroococcum
Brite
KEGG Orthology (KO) [BR:acx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Achr_21630
Enzymes [BR:acx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Achr_21630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_7 Glutaredoxin Thi4 K_oxygenase NAD_binding_8 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJE21612
UniProt: A0A0C4WTJ7
LinkDB All DBs
Position
2405256..2406821
Genome map
AA seq 521 aa AA seqDB search
MLDESLKTQLQAYLERVTLPFEIVATLDGSAKSQEMLGLLQDIQGLSDKITLRTDGKDAR
VPSFALARPGADIFLRFAGIPMGHEFTSLVLALLQVGGYPSKASEEAIAQIKALDGEYRF
ETYFSLSCQNCPDIVQALNLMAVLNPRISHVAIDGALFQDEVEKRQIMAVPTIYLNGEPF
GQGRMELEQILAKLDTGASAREAEKLNAREAFDVLVVGGGPAGSSAAIYAARKGIRTGVV
AERFGGQVLDTMDIENFISVPETEGPKLARALEEHVRQYEVDIMNLQRAVKLVPAAAKGG
LHEVQFESGASLKAKAVILATGARYRALGVPGEQEYRTRGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLTHGEKLRADAVLQRKLHSLPNVTVLLNAPIAEVVGDG
QKVNGLVYKERLSGEAHRIELEGVFVQIGLLPNSEWLKGSVELTERGEIITDAHGSTTVP
GVFAAGDVTTVPYKQIVIAVGEGAKASLGAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgagagccttaagactcagctgcaggcctacctggaacgcgtcaccctgccc
ttcgagatcgtcgccacccttgacgggagtgccaagtcgcaggagatgctcggcctgctg
caggacatccaggggctgagcgacaagatcaccctgcgcaccgacggcaaggacgcacgc
gtcccgtccttcgccttggcgcgtccgggcgcggacatcttcctgcgcttcgccggcatc
cccatgggccacgagttcacctccctggtgctggccctgctgcaggtcggcggctatccg
tccaaggccagcgaggaagccatcgcgcagatcaaggccctcgacggcgaataccgcttc
gaaacctacttctcgctgtcctgccagaactgcccggacatcgtccaggcgctgaacctg
atggcggtgctcaaccccaggatcagccacgtcgccatcgacggcgcgctgttccaggac
gaggtcgagaagcgccagatcatggccgtgccgaccatctacctgaacggcgagccgttc
ggccagggccgcatggagctcgagcagatcctcgccaagctcgacaccggcgccagcgcc
cgcgaagccgagaagctcaacgcccgggaagccttcgacgtgctggtggtcggcggcggc
ccggccggctcttcggcggccatctacgcggcgcgcaagggcatccgcaccggcgtggtg
gccgagcgcttcggcggccaggtgctggacaccatggacatcgagaacttcatctccgtg
ccggagaccgaaggcccgaaactcgcccgcgccctggaagagcacgtccgccagtacgaa
gtcgacatcatgaacctgcagcgcgcggtcaagctggtgccggccgccgccaagggcggt
ctgcacgaggtgcagttcgagtccggcgcctcgctcaaggccaaggccgtgatcctcgcc
accggcgcccgctaccgcgccctcggcgtgcccggcgagcaggaataccgcaccaggggc
gtggcctactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtcgaggcggccatcgacctggccggcatcgtcgcccacgtc
accctgctgacccacggcgagaagctgcgcgccgacgcggtgctgcagcgcaagctgcac
agcctgccgaacgtcaccgtgctgctcaacgcgccgatcgccgaagtggtcggcgacggc
caaaaggtcaacggcctggtctacaaggagcgcctcagcggcgaagcgcaccgcatcgag
ctggaaggcgtgtttgtgcagatcggcctgctgccgaacagcgagtggctgaagggcagc
gtcgaactcaccgaacgcggcgagatcatcaccgacgcccacggcagcaccacggttccc
ggcgtgttcgccgccggcgacgtcaccacggtgccctacaagcagatcgtcatcgccgtg
ggcgaaggcgccaaggcttccctgggcgccttcgaccacctgatccgcacctcggcgccg
gcctga

DBGET integrated database retrieval system