KEGG   Azotobacter chroococcum: Achr_25450Help
Entry
Achr_25450        CDS       T03640                                 

Gene name
sodA
Definition
(GenBank) CU-Zn Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
acx  Azotobacter chroococcum
Brite
Enzymes [BR:acx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Achr_25450 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu ToxB_N
Motif
Other DBs
NCBI-ProteinID: AJE21976
UniProt: A0A0C4WN89
LinkDB All DBs
Position
2858069..2858611
Genome map
AA seq 180 aa AA seqDB search
MHNKEKPMKKWLIAALAASCALPLQAAPLSVTLDAVSGDGIGAALGTVSIEQNEHGLVFT
PNLEGLQPGIHGFHVHASGSCAVAEKDDQKVAAGAAGGHWDPQNTAKHGQPWGDGHLGDL
PALYVGADGKATQPVLAPRLKDLAALKGHALMVHAGGDNHADSPAPLGGGGARVACGIIK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacaaggagaaacccatgaagaaatggctgattgcagcactggccgccagctgc
gcactgcccctgcaggccgcgccgctcagcgtcacgctcgacgcggtgagtggcgacggc
atcggcgcagcgctcggcaccgtcagcatcgagcagaacgaacacggcctggtcttcacc
cccaacctcgagggactgcaacccggcattcatggcttccacgtccacgcctcgggcagc
tgcgccgtcgcggaaaaggacgaccaaaaggtcgctgccggcgccgccggcggccactgg
gatccgcagaataccgcaaagcatggccagccctggggagacggccacctgggcgacctg
ccggccctctacgtgggtgccgacggcaaggccacgcaaccggtgctggcaccgcgcctg
aaggacctggcggcactcaagggccatgccctgatggtgcatgccggtggcgacaatcat
gccgacagccccgcgccgctgggcggtggcggagcccgggtggcctgcggcatcatcaag
tga

DBGET integrated database retrieval system