KEGG   Azotobacter chroococcum: Achr_28300Help
Entry
Achr_28300        CDS       T03640                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
acx  Azotobacter chroococcum
Pathway
acx00520  Amino sugar and nucleotide sugar metabolism
acx01100  Metabolic pathways
acx01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Achr_28300
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Achr_28300
Enzymes [BR:acx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Achr_28300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AJE22252
UniProt: A0A0C4WUR9
LinkDB All DBs
Position
complement(3183709..3184707)
Genome map
AA seq 332 aa AA seqDB search
MQGSLMLDIAGTWLTAEDRRLLRQPEVGGLILFARNIEHPAQVRELCAAIRAVRPDLLLA
VDQEGGRVQRLRQGFVRLPAMGALAGCDEAEQLAEACGWLMATEVLAAGLDFSFAPVLDL
DHGRSAVIGSRGFAGDPQAVIRLAGAFIRGMHAAGMAATGKHFPGHGWAEADSHVAIPTD
ERSLEAIRARDLLPFQQLRGQLDAVMPAHVIFPQVDAQPAGFSRRWLQDILRGELGFDGV
VFSDDLSMAGAHVAGDAAARVEAALAAGCDMGLVCNERAAAELALSALQRLGVQPAPRLA
RMRRRAFPGIDYKQNPRWLRALESLRQARLID
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggctctttgatgctggacatcgccggcacctggctgaccgccgaggatcgccgc
ctgctgcgccagcccgaagtgggcggcctgatcctgttcgcccgcaatatcgagcacccc
gcccaggtccgcgagctctgtgcggcgattcgcgccgtgcgtcccgacctgctgctcgcc
gtggaccaggagggcggccgcgtgcagcgcctgcgccagggcttcgttcgcctgccggcg
atgggtgcgctggccggctgcgacgaggccgagcaactggccgaggcgtgcggctggctg
atggcgaccgaggtgctggcggcggggctggacttcagtttcgcgccggtgctggacctc
gaccacgggcgcagtgcggtgatcggctcgcgcggcttcgccggcgatccgcaggcggtc
atccgcctggccggggccttcatccgcggcatgcatgccgccggtatggccgccaccggc
aagcattttccgggacatggctgggcggaggccgactcccatgtggccatccccaccgac
gagcgcagtctcgaggcgatccgcgcccgggacctgctgcccttccagcagctccgcggg
cagctggatgccgtgatgccggcacacgtcatcttcccgcaggtggatgcacagccggcc
ggcttctcccggcgctggctgcaggacatcctgcgcggcgagctgggcttcgacggggtg
gtgttcagcgacgacctgtcgatggccggcgcccatgtggccggcgacgcggcggcgcgg
gtcgaggcggcactcgccgcaggctgcgacatggggctggtgtgcaatgagcgggcggcg
gccgaactggccctgtccgccctgcagcgcctcggcgtgcagccggcaccccgcctggca
cgcatgcgtcggcgggccttcccggggatcgactacaagcagaacccacgctggctgcgc
gcactcgagagtctgcgccaggcccggctgatcgattga

DBGET integrated database retrieval system