KEGG   Azotobacter chroococcum: Achr_33250Help
Entry
Achr_33250        CDS       T03640                                 

Definition
(GenBank) Zinc-containing alcohol dehydrogenase superfamily
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
acx  Azotobacter chroococcum
Pathway
acx00010  Glycolysis / Gluconeogenesis
acx00071  Fatty acid degradation
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01120  Microbial metabolism in diverse environments
acx01130  Biosynthesis of antibiotics
acx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achr_33250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Achr_33250
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Achr_33250
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Achr_33250
   00626 Naphthalene degradation
    Achr_33250
Enzymes [BR:acx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Achr_33250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJE22732
UniProt: A0A0C4WVK0
LinkDB All DBs
Position
3723365..3724393
Genome map
AA seq 342 aa AA seqDB search
MAKTMKAAVVVAFGKPLEIREVPVPTPGPGQLLVKIAACGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGQVVAVGAGVSHIKEGDRVGIPWLHSACGHCEHCLGGWETLCHAQSNTGYSV
NGGFAEYALAEAEYAGRLPDNADFIEIAPILCAGVTVYKGLKMTDTRPGQWVAISGVGGL
GHMAVQYARAMGLNVAAVDVDDAKLEFARRLGASLTVNARQQDPAAFLQQEIGGMHGVLV
TAVSPKAFEQALGMTRRGGTVALNGLPPGEFSLSIFDMVLNGTTVRGSIVGTRLDLQEAL
DFAGQGKVRATVASEPLENINDIFARMHKGQIEGRIVLDLAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacgatgaaggctgccgttgtcgtcgcgttcggcaagccgctggagatccgc
gaagtaccggtgcccactcccggccccgggcaactgctggtgaagatcgccgcctgcggc
gtctgccacaccgacctgcacgccgccgaaggcgactggccggtcaagcccaatcccccc
ttcattcccggccacgaaggcgtcggccaggtggtcgccgtgggcgccggcgtcagccac
atcaaggaaggcgaccgggtcggcattccctggctgcactccgcctgcggccactgcgag
cactgcctgggcggctgggaaaccctctgccacgcgcagagcaacaccggctactcggtg
aacggcggcttcgccgaatacgccctggccgaggccgaatacgccggccgcctgccggac
aacgccgacttcatcgagatcgcccccatcctctgcgccggggtgaccgtctacaagggc
ctgaagatgaccgacacccgtcccggccagtgggtggcgatctccggcgtcggcggcctc
ggccacatggccgtgcagtacgcccgggccatgggcctgaacgtcgccgccgtggacgtc
gacgacgccaagctggagttcgcccggcggcttggcgccagcctcaccgtcaatgcccgc
cagcaggacccggcggccttcctgcagcaggaaatcggcggcatgcacggcgtgctggtc
accgccgtctcgccgaaggccttcgagcaggccctgggcatgacccgccgcggcggcacc
gtcgccctcaacggcctgccgcccggcgagttcagcctgtcgatcttcgacatggtgctc
aacggcaccacggtgcgcggctccatcgtcggcacccgcctggacctgcaggaagcgctg
gacttcgccggccaaggcaaggtgcgggccacggtcgccagcgagcctttggaaaacatc
aacgacatcttcgcccgcatgcacaaggggcagatcgaaggccgcatcgtcctcgacctc
gccgcctga

DBGET integrated database retrieval system