KEGG   Azotobacter chroococcum: Achr_35970Help
Entry
Achr_35970        CDS       T03640                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
acx  Azotobacter chroococcum
Pathway
acx00500  Starch and sucrose metabolism
acx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Achr_35970
Enzymes [BR:acx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Achr_35970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 DUF1793
Motif
Other DBs
NCBI-ProteinID: AJE22992
UniProt: A0A0C4WVX9
LinkDB All DBs
Position
4002540..4004957
Genome map
AA seq 805 aa AA seqDB search
MQPIRFRKTLLSVMVSAVGLCQTALGAAPGTGVVESVAPGAPGNAPFWSYSGKTGIGTSY
EQYNEDGQYGRSAATGPVSKVWFSLAQGIVTETMFGLIHEAQLRELQLVIQGPDFVDLEA
QDTDSEIHYLSVDGEGRPNSLAYKIINRDKEGLYEIEKHVFTDPNTNSLMMRVNFRSTDP
AIQAYVHVDPAIGNTGSGDTAFVDRQALYAQQDETTLVVKASQPLENATVGFVGTSDGLT
DLKKDGKLDNQHTSTGSQQGNVALLARLPLTGTETTIDLVVGFGKSRKEADKAADKTLAR
GYAKVLAHYNGEGKAIGWQDYLQSLPALPAMYAQSTDNGKLLNVSAMVLKAQEDKSNAGA
LIASLSNPWGDTTSAEQSSTGYKAVWPRDFYQCAMALLALGDRQTPKVAFEYLKKVQVRE
DTPGNEGATGWFLQKTHVDGELEWMSVQLDQTAMPIMLGWKLWQAGILDDNQITDWYQNM
LKPAAEFLVKGGQIKLGWNDWNITPPLTQQERWEEQWGYSPSTTAALIAGLTAASDIAEH
AGDTNAAQTFLNTAKSYSDKVEASMFTRSGELGDGRYYLRITQNDDPNDGGTLSYSNGYA
GLPESQILDAGFLELVRYGVRPATDPHIIDSLGELDSQVLPEHLKLKYTFTYPGVVGEFP
GWRRYGNDGYGENQNTGGNWMTSEPGSDRGRVWPFFTGERGHYELALAKARLPEGVSALS
DEQLMQLKNTYVKSMELFANEGMMLPEQVWDGVGDNSAHGFEKGEGTNSATPLAWTHAEY
VKLVRSMTDQAVWDHYPIVPEKLAQ
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaataaggttccgcaaaacactgctgagcgtcatggtaagcgccgtgggcctc
tgtcaaaccgcgctgggtgccgcccccggtaccggcgtggtggagagcgtggccccgggc
gcgccgggaaacgcaccgttctggtcctattcgggaaaaaccggtatcggtacctcctac
gagcagtacaacgaagatggccaatatggccgttcggcggccaccggtcccgtgtcgaaa
gtctggttttccctggcccaggggatcgtcaccgagaccatgttcggcttgattcatgaa
gctcagctcagggagttgcaactggttatccaggggccggacttcgtggatctggaagcg
caggacaccgacagcgaaatccactacctgtcggtcgacggcgagggccgccccaattcg
ctcgcctacaaaatcatcaatcgcgacaaggaaggcctgtacgagatcgagaaacacgtg
ttcaccgatccgaacacgaactccctgatgatgcgggtcaacttccgcagcaccgatccg
gccatccaggcctatgtgcacgtcgatccggcgatcggcaacaccggcagcggcgatacc
gccttcgtcgaccggcaggcgctgtacgcccagcaagacgagacgacgctggtcgtcaag
gccagccagcccctggagaacgccaccgtcggctttgtcggaacctccgacggcctgacc
gacctgaagaaggatggcaagctcgacaaccagcacaccagcactgggtcacagcagggc
aacgtcgccctgctggcgcgccttcccctgacgggcaccgaaaccacgatcgacctggtc
gtcgggttcgggaagagccgcaaggaagccgacaaggccgcggacaagacgcttgcccgc
ggctacgccaaggtgctggcccactacaatggcgagggcaaggcgatcggctggcaggat
tatctgcaatccctgcccgccctgccggccatgtatgcgcagagcacggacaacggcaag
ctgctcaacgtcagcgccatggtgctcaaggcccaggaggacaagagcaacgccggggcg
ctgatcgcctccctgtccaacccctggggcgatacgacttccgccgagcagagcagtacc
ggctacaaggccgtctggccacgtgacttctaccagtgcgcgatggcgctgctggcgctc
ggcgaccgccagacgccgaaggttgccttcgaatacctgaagaaggttcaggtcagggaa
gacacccccggcaacgagggcgctaccggctggttcctgcaaaagacccatgtcgatggc
gagctcgaatggatgtcggtccagctcgaccagaccgccatgcccatcatgctgggctgg
aaactctggcaggccgggatactggacgacaaccagatcaccgactggtaccagaacatg
ctcaagccggcggcggaattcctggtcaagggcggtcagatcaaactcggctggaacgat
tggaacatcaccccaccgctgacccagcaggagcgctgggaagagcaatggggctactcg
ccctcgaccacggcagcactcatcgccggtctgacagcggcctccgacatcgccgagcat
gcgggtgataccaatgcggcgcagactttcctgaacaccgcaaaaagttactccgacaaa
gtggaagcgagcatgttcacccgcagcggcgagctgggcgacggacgctattacctgcgc
atcacccagaacgacgaccccaacgacggcggcaccctgagttacagcaacggctatgcc
ggactgccggaaagccagattctcgacgccggttttctggagctggtgcgttacggcgtt
cgccccgccaccgatccccacatcatcgattcgctgggagagctcgacagccaggtgctg
cccgagcacttgaagcttaaatacaccttcacctaccccggagtcgtaggcgaattcccc
ggctggcgtcgctacggcaacgatggctacggtgaaaatcaaaacaccggcggcaactgg
atgacctccgagccgggctcggaccggggccgggtctggccgttctttaccggcgagcgg
ggccattacgagctggcgctcgccaaggcccggttgccggaaggggtcagcgcgttgagc
gacgagcaactgatgcagctcaaaaacacctacgtcaagagcatggagctgttcgccaat
gaaggcatgatgctgccggaacaggtctgggacggcgtgggtgacaacagcgctcatggc
ttcgagaagggagaaggcacgaactccgccacccccctggcctggacccatgccgaatac
gtcaagctggttcgctcgatgaccgaccaggcggtgtgggatcactaccccatcgtcccg
gaaaaactcgcgcaatga

DBGET integrated database retrieval system