KEGG   Azotobacter chroococcum: Achr_7340Help
Entry
Achr_7340         CDS       T03640                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
acx  Azotobacter chroococcum
Brite
KEGG Orthology (KO) [BR:acx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acx01004]
    Achr_7340
Enzymes [BR:acx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Achr_7340
Lipid biosynthesis proteins [BR:acx01004]
 Acyl-CoA synthetase
  Unknown
   Achr_7340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AJE20233
UniProt: A0A0C4WGP0
LinkDB All DBs
Position
816173..817990
Genome map
AA seq 605 aa AA seqDB search
MLPASLSDPLQGTVVALKNARTGMMAKPAMSATPTQNALAPRLADFSTLAEALDYAALGH
TGLNFYDGRCRLTAVVPYAEVRREARALARRLHGLGLRRGDRVALIADTEPGFMEAFYGC
QYAGFIPVPLPIPSGLGSHAAYVEKLASLLKSCEPSAVLAPAAWLPFAQEAAASFRTLFV
GSVDEMKGRAVPPVELEPSRPDEVAYLQYTSGSTRFPRGVVVTQQAAMANLQGMIRDGLG
VRPGDRCVSWLPFYHDMGLVGFVLGPMASQLSVDYLRTQDFAMRPRQWLNLISQNRGTIS
FAPPFGYDLCARRVREGEAAQFDLSSWRIAGTGAEPIRAEVLERFAEQFAPAGFARTAFL
PCYGLAECTLGASFGRRGAGVVVDRIERHALEHQSMAVPFGGEESQASTFVNCGAVLPGH
RLEIRDEAGRSLPERRVGRVMLQGPSVMSGYFRDEESTQAALDGGWLDTGDLGYLSAGEL
FITGRQKDLLIVRGRNIWPQDVEYLVESQSEVRPGDVIAFLVPAVPDPQVVVQVQCRVSD
PEKRKQLVRALAGLISSEFGFIALVELVPPHSLPRTSSGKPSRAEARKRFLAQAQSAPGL
SMVCG
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggcctcgctgagcgatccgctgcagggaacggttgttgcgctgaaaaatgcc
aggactggaatgatggccaaacccgctatgtctgcaactcctacgcaaaacgccctggct
ccgcgcctggcagacttctcgacactggcagaggccctcgattacgcggcgctggggcat
accggcctgaatttctatgacgggcgctgccgcctgacggctgtggttccctatgccgag
gtgagacgggaggcgcgggccctggccaggcgcctgcatgggctcgggttgcgccggggt
gaccgggtagccttgatcgccgacactgagccgggattcatggaggccttctatggctgc
caatatgccgggttcattccggtgccgctgcccattccgtccgggctgggcagccatgcc
gcctatgtcgagaaactcgcctcgctgctgaagagctgcgagccctccgccgtcctggcg
cctgccgcgtggctgccgttcgcgcaggaggcggccgcgtctttccgcacgctcttcgtc
ggctcggtcgatgagatgaagggacgggcggttccgccggtggaactggagccttcccgg
ccggacgaggtggcctatctgcaatacacctcggggagcacccgcttcccgcgcggcgtg
gtggtgacgcagcaggcggcgatggccaatctgcaaggtatgatccgcgacgggctgggc
gtgcgtcccggcgaccgctgtgtctcctggctgccgttctatcacgacatgggactggtg
ggcttcgtgctgggcccgatggcctcgcagttgtcggtggactacctgcgtacccaggat
ttcgccatgcgaccccggcaatggctcaacctgatcagccagaaccgcggcaccatctcg
ttcgcgccgcccttcggctatgacctgtgcgcccgtcgcgttcgggagggcgaggcggcc
cagttcgacctctccagctggcgcattgccggtaccggcgcggagccgatacgcgcggag
gtgctggagcgcttcgccgagcagttcgccccggcgggcttcgcgcggacggccttcctg
ccctgctatggcctggcggagtgcaccctgggcgccagcttcggccgtcgtggcgcgggg
gttgtggtggaccgcatcgagcgccatgccctggagcaccagtcgatggccgtacccttc
ggcggcgaggaaagccaggccagcaccttcgtcaactgtggtgccgtgcttcccgggcac
cgcctggaaatccgcgacgaggccggacgctccctgccggagcgtcgagtcgggcgggtg
atgctgcaggggccgagcgtgatgtcggggtatttccgcgacgaggaatccacgcaggcg
gctctggacggcggctggctggataccggcgatcttggctatctgagcgctggcgagttg
ttcatcaccggccggcagaaggatctcctgatcgtgcgcggccggaacatctggccgcag
gacgtcgagtatctggtcgagtcccagtccgaggtgcggccgggcgacgtgatcgccttc
ctcgttcccgcggttcccgatccccaggtcgtggtgcaggtccagtgccgggtcagcgac
ccggaaaagcgcaagcagctggtgcgcgccctggccgggctgatcagcagcgaattcggc
ttcatcgctctcgtcgagctggttccgccccattccctgccacgcacctcgtcgggcaag
ccctcgcgggccgaagcgcgcaagcgtttcctggctcaggcacagtctgcgcccgggctg
tccatggtctgcgggtag

DBGET integrated database retrieval system