KEGG   Azotobacter chroococcum: Achr_8720Help
Entry
Achr_8720         CDS       T03640                                 

Gene name
adh
Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)-and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
acx  Azotobacter chroococcum
Pathway
acx00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Achr_8720 (adh)
Enzymes [BR:acx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Achr_8720 (adh)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Achr_8720 (adh)
    1.1.1.-  
     Achr_8720 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AJE20356
UniProt: A0A0C4WK42
LinkDB All DBs
Position
complement(967560..968642)
Genome map
AA seq 360 aa AA seqDB search
MTTSLGATMRAAVWHGRQDIRVEDVPLPADPPPGWVQIRVDWCGICGSDLHEYVAGPVFI
PVEKPHPLTGIQGQCILGHEFSGEIVKLGAGVSGFAPGERIAADACQHCGTCYYCRSGLY
NLCEKLAFTGLMNNGAFAELVNVPAELLYKLPANFPAEAGALIEPLAVGMHAVKKAGSLL
GQNVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKALEVGASLVLDPKECDVLAE
IRARTHGLGADVSFECIGNKHTAKLAIDVIRNAGKSVLVGIFEEPSSFNFFELVSTEKQV
IGALAYNGEFADVIAFIADGRLDVKPLITGRIGLEDIVGRGFEELVNNKEHNVKIIVSPH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatcccttggtgcaaccatgcgcgccgccgtctggcacggccgtcaggacatc
cgcgtcgaagacgtgccgctgcccgccgacccgccgcccggctgggtgcagatccgcgtc
gactggtgcggcatctgcggttcggacctgcacgagtacgtcgccggcccggtgttcatc
ccggtcgagaagccccacccgctcaccggcatccagggccagtgcatcctcggccacgaa
ttcagcggcgagatcgtcaagctcggcgccggcgtgagcggcttcgcccccggcgaacgg
atcgccgccgacgcctgccagcactgcggcacctgctactactgccgcagcggcctgtac
aacctctgcgaaaaactggccttcaccgggctgatgaacaacggtgccttcgccgaactg
gtgaacgtgccggccgaactgctctacaagttgccggccaatttccccgccgaggccggc
gcgctgatcgaaccgctggcggtgggcatgcacgcggtgaagaaggccggcagcctgctc
ggccagaacgtggtggtggtcggcgccggcaccatcggcctgtgcaccatcatgtgcgcc
aaagcggccggcgcggcccaggtgatcgccctggaaatgtcctcggcgcgcaaggccaag
gcgctggaagtgggcgccagcctggtgctcgatcccaaggaatgcgacgtgctggcggaa
atccgcgcccgcacccacggcctcggcgccgacgtcagcttcgagtgcatcggcaacaag
cacaccgccaaactggccatcgacgtcatccgcaacgccggcaagagcgtgctggtcggc
atcttcgaggaacccagttcgttcaacttcttcgaactggtctccaccgagaaacaggtc
atcggcgccctcgcctacaacggcgaattcgccgacgtgatcgccttcatcgccgacggt
cgcctggacgtcaaaccgctgatcaccggccgcatcggcctggaggacatcgtcggccgc
ggcttcgaggaactggtcaacaacaaggaacacaacgtcaagatcatcgtttcgccgcat
tga

DBGET integrated database retrieval system