KEGG   Azotobacter chroococcum: Achr_b10
Entry
Achr_b10          CDS       T03640                                 

Name
(GenBank) RelB/DinJ family Addiction module antitoxin
  KO
K07473  DNA-damage-inducible protein J
Organism
acx  Azotobacter chroococcum
Brite
KEGG Orthology (KO) [BR:acx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:acx02048]
    Achr_b10
Prokaryotic defense system [BR:acx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YafQ-dinJ
    Achr_b10
SSDB
Motif
Pfam: RelB RHH_1 Ribosomal_S30AE DUF6290
Other DBs
NCBI-ProteinID: AJE23475
UniProt: A0A0C4WUD3
LinkDB
Position
pAcX50b:2118..2435
AA seq 105 aa
MRYTCGGIPLENAMATHTSMLHIRVDDDIKAQANAALEAMGLSMSEAVRIFLRRVAADQA
FPLELKVPNAETRSAMAEAEAIVQAHEARFESIDDLFDDLEKRSQ
NT seq 318 nt   +upstreamnt  +downstreamnt
ttgagatacacttgtgggggaattcccttggagaacgctatggctacccatacgtccatg
ctgcatatccgcgtcgatgacgatatcaaggcacaggccaacgccgccctggaggcgatg
ggcctaagcatgtctgaagcggtgcggatctttctgcgccgcgtagccgcagatcaggcc
tttccgctcgaactcaaggtaccgaacgcggaaacccggtcggcgatggctgaggcggaa
gccatcgtgcaggctcatgaggcacgctttgaatccattgacgatttgtttgatgacctc
gaaaaacgcagccagtag

DBGET integrated database retrieval system