KEGG   Azotobacter chroococcum: Achr_b40
Entry
Achr_b40          CDS       T03640                                 

Name
(GenBank) Transposase, IS4 family
Organism
acx  Azotobacter chroococcum
SSDB
Motif
Pfam: DUF772 DDE_Tnp_1 DDE_Tnp_1_6 DDE_Tnp_1_2
Other DBs
NCBI-ProteinID: AJE23478
UniProt: A0A0C4WT34
LinkDB
Position
pAcX50b:complement(4336..5442)
AA seq 368 aa
MQPQLKPMRGLDLKQDELFSYTTLEQRIPSDHPLRPLRKLVDTVLASMDQDFDGLYSTRG
RASIAPERLLRASLLQVIYTVRSERQLVEQIDFNLLFRWFVGLSMDEPVWDHSTFSQNRD
RLFNQEVARLFFQRIKSLEQWPGYASDEHFSVDGTLIDAWASHKSFVRKDGGEPPKDGTR
NPYADFKGEKRSNATHRSKTDPEARLARKNKGDASRLAHMAHTMIAHRSGLIVDVECTEF
NGHAEVEAALAMLERTAKPGSTVGADKNYDQQAFVQGARKLKVTPHVAQKAKSSAIDGRT
TRHEGYTTSLKIRKRIEEGFGWLKTVGGLRKTKLIGRAKLSAQLLLGFSVYNLIRLGSLS
GWWRGSHV
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgcagccccaactcaagccgatgcgtggactcgacctcaagcaagacgagctgttcagc
tacacgacgctggaacagcgcatccccagcgatcatccgctgcgcccactgcgcaagctc
gtcgataccgtcctggcctcgatggatcaggacttcgacggcttgtactccacgcggggg
cgggcctcgatcgcacccgagcggctgttgcgcgcctcgttgctccaggtgatctacacc
gtccgctcggagcgacagctggtcgagcagatcgacttcaatctattgtttcgctggttc
gtcggcctgtcgatggacgagccggtgtgggatcactcgaccttcagccagaaccgcgac
cggctgttcaaccaggaggtggcgcgcctgttcttccagcgcatcaagtcgctggagcag
tggcccgggtacgccagtgacgagcatttcagcgtggacggcacgctgatcgacgcctgg
gcttcgcacaagtccttcgtgcgcaaggacggcggcgagccgccgaaggatggcacgcgc
aacccctacgccgacttcaagggcgagaagcgcagcaacgccacccatcgctcgaagacc
gatcccgaggcccgtctggcgcgcaagaacaagggggacgccagccgcctggcgcatatg
gcacacacgatgatcgcgcaccgcagcgggctgatcgtggatgtggaatgcaccgaattc
aacgggcatgccgaagtcgaggccgcgctggccatgctggagcgcacggccaagccgggc
agcacggttggggcggacaagaactatgaccagcaggccttcgtccagggtgcgcgcaaa
ctgaaggtgacgccgcatgtagcacagaaagccaagagcagcgccatcgatgggcgcacc
acgcgccatgagggatacacgaccagcctgaagatccgcaagcggatcgaggagggtttt
ggctggctgaagacggtgggtgggctgcgcaagaccaagctgatcggccgggcgaagttg
agtgcccaactgctgctgggcttctcggtctacaacctgatccgcctggggagcctgtcg
ggctggtggcgaggctcgcatgtatag

DBGET integrated database retrieval system