KEGG   Azotobacter chroococcum: Achr_b60
Entry
Achr_b60          CDS       T03640                                 

Name
(GenBank) Hypothetical protein
Organism
acx  Azotobacter chroococcum
SSDB
Motif
Pfam: Retrotran_gag_3
Other DBs
NCBI-ProteinID: AJE23479
UniProt: A0A0C4WS40
LinkDB
Position
pAcX50b:6972..7388
AA seq 138 aa
MVELEQLQDAGRQRIELTGYELVQMPRQGRAAAWTWRMTAANYAAWQERLRTVIRHHDEP
GIQQFLHSLRRTPPFAESRRQAFELGRLAQAEWQRSQRGPCPYDGLYVGWFGRFQAAKVL
PVSARGRCKQGRDLRLMD
NT seq 417 nt   +upstreamnt  +downstreamnt
gtggtcgagctggagcagctgcaggacgctggccgccagcggatcgagctgaccggctac
gaactggtgcagatgccgcgccagggccgggcggcggcgtggacctggcggatgacggcg
gcgaactacgccgcctggcaggagcggctgaggacggtcatccggcaccacgacgagccg
ggtatccagcagttcctgcacagcctgcgcaggaccccgccgttcgccgagagccggcgg
caggccttcgagctgggcagactggcccaggccgagtggcagcgcagccagcgtggcccc
tgcccatatgacggactgtatgttggttggtttgggcgattccaggcggcgaaggtgctc
ccggtctcagccagggggaggtgcaaacaggggcgtgacttgcgccttatggattaa

DBGET integrated database retrieval system