KEGG   Azotobacter chroococcum: Achr_b90
Entry
Achr_b90          CDS       T03640                                 

Name
(GenBank) Initiator Replication family protein
Organism
acx  Azotobacter chroococcum
SSDB
Motif
Pfam: Rep_3 RPA RNA_pol_I_A49 DUF4248
Other DBs
NCBI-ProteinID: AJE23482
UniProt: A0A0C4WWY3
LinkDB
Position
pAcX50b:complement(10706..11539)
AA seq 277 aa
MPKDLQVVKSNHIISASYRLSVIEQRIILCCIAQVCRDETITDEVLYSVRASDLAELCGT
DMRRAYRDLAEAAERLYERRITILFEPDGKPRAARKRLTRWVQDVDYIEGEGRIELRFGK
TILPFLTGLTEHFTRYQLSAVARMTSAHAIRLFELLAQYGSVGEREISLEQLQEWLQLEG
NYSMFADLKRRVIEPAVAQVNEHSPLAVKWEQRKTGRKVTHLVFTFGPKKTTKAAAKGAN
TALTPAGMTDTEMAAYARPGETWEQLRARLRKAGTAA
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcctaaagacctgcaggtagtgaagtcgaaccacatcatttccgcgtcataccgcctt
agcgtcatcgagcagaggatcatcctgtgctgcattgcccaggtttgccgcgatgagacg
attacggatgaggtcctatattcggtcagggcctccgacctcgctgagctgtgcggcacc
gatatgcggagagcatatcgggatcttgcagaggcggctgagcggctttacgagaggcgt
ataacgatcctattcgagccagacggaaagcccagagcagcccgcaagcgcctcacccga
tgggtgcaagacgttgattacatcgagggggaaggccgtatagagctgcgattcggtaag
accatcctgccgttcctaacaggcttgactgagcacttcacccgctatcagctatcggca
gtggcaaggatgaccagtgcccatgccatccgcctgttcgagctactggctcaatacggc
agcgtaggggaaagggagatcagccttgagcaactacaggagtggctccaactggagggc
aactattcgatgtttgccgacctcaagcgccgggtcattgagcctgctgtagcccaggtc
aacgagcacagccccttagccgtgaagtgggagcagcgcaaaaccggccgcaaagtcacg
cacctggtgttcaccttcggtccgaagaaaaccaccaaggccgcggccaagggcgcgaac
actgctctcactcctgccggcatgaccgatacggagatggccgcctacgctcggccaggc
gagacctgggagcaactgcgcgccaggctgaggaaggcaggcacggccgcctaa

DBGET integrated database retrieval system