KEGG   Anabaena cylindrica: Anacy_0031Help
Entry
Anacy_0031        CDS       T02435                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
acy  Anabaena cylindrica
Pathway
acy00630  Glyoxylate and dicarboxylate metabolism
acy00710  Carbon fixation in photosynthetic organisms
acy01100  Metabolic pathways
acy01120  Microbial metabolism in diverse environments
acy01200  Carbon metabolism
Module
acy_M00165  Reductive pentose phosphate cycle (Calvin cycle)
acy_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
acy_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:acy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Anacy_0031
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Anacy_0031
Enzymes [BR:acy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Anacy_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFZ55646
UniProt: K9Z8Z9
LinkDB All DBs
Position
36544..36873
Genome map
AA seq 109 aa AA seqDB search
MQTLSKERRYETLSYLPPLSDAQIAKQVQYILSQGYIPAIEFNETSEPTELFWTMWKLPL
FGAKTTQEVLSEVQGCRSQFGNCYVRVVGFDNIKQCQVLSFIVHKPSRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttatcaaaagagcgtcgttacgaaactctctcttatcttccccccctgtct
gatgctcaaattgccaaacaagttcagtacattctgagccaaggctacatcccagcaatc
gagtttaacgaaacttctgaaccaaccgaattgttctggacaatgtggaagctacctttg
tttggtgctaaaaccactcaagaagtattgagtgaagttcaaggttgccgttctcagttc
ggtaactgctatgttcgtgttgttggttttgacaacatcaaacagtgtcaagttctcagc
tttatcgttcacaaacccagcagatactaa

DBGET integrated database retrieval system