KEGG   Anabaena cylindrica: Anacy_0165Help
Entry
Anacy_0165        CDS       T02435                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
acy  Anabaena cylindrica
Brite
Enzymes [BR:acy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Anacy_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: AFZ55773
UniProt: K9Z9A5
LinkDB All DBs
Position
183843..184442
Genome map
AA seq 199 aa AA seqDB search
MAFSQLPLPFDFNALEPYGMKGETFEYHYGKHHKAYVDNLNKLTDGTELADKSLEEVIQI
SFKDSSKAGIFNNAAQVWNHTFFWNSLQPAGGGAPTGELAAKIDKDFGSFDKFKEEFSTA
AATQFGSGWAWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDYRNARPAFI
KNFLDQLVNWEFAAANLAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcacaacttccactacccttcgactttaatgctctagagccttatggtatg
aaaggtgaaacctttgaatatcactatggtaagcatcataaagcttatgtagataacctc
aacaagctcaccgatggtacagaacttgctgataagtccctcgaagaagtaattcaaatt
tccttcaaagactcctctaaagctggtatcttcaacaacgcggctcaagtttggaaccat
accttcttttggaactcactccaacccgcaggtggtggcgctcctaccggtgaactagct
gctaagattgacaaagattttggtagttttgacaaattcaaagaagaattttctactgcg
gctgcaacccagtttggtagcggttgggcttggttaattgatgatggtggtacgctgaag
gtgattaagacaccaaatgcagaaaaccctttagctcatggtaaaaaggcacttctcacc
ctagatgtttgggaacacgcctactacattgactacagaaatgcgcgtccagcattcatc
aaaaatttcttagatcaattggttaactgggaatttgctgctgcaaatctagctgcttaa

DBGET integrated database retrieval system