KEGG   Anabaena cylindrica: Anacy_0663
Entry
Anacy_0663        CDS       T02435                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acy  Anabaena cylindrica
Pathway
acy00010  Glycolysis / Gluconeogenesis
acy00020  Citrate cycle (TCA cycle)
acy00620  Pyruvate metabolism
acy01100  Metabolic pathways
acy01110  Biosynthesis of secondary metabolites
acy01120  Microbial metabolism in diverse environments
acy01200  Carbon metabolism
Module
acy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anacy_0663
   00020 Citrate cycle (TCA cycle)
    Anacy_0663
   00620 Pyruvate metabolism
    Anacy_0663
Enzymes [BR:acy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Anacy_0663
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Other DBs
NCBI-ProteinID: AFZ56253
UniProt: K9ZAP0
LinkDB
Position
799782..801086
AA seq 434 aa
MSIHEVFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGFLAHI
IVPAGETAPVGAAIAYVAETEAEIETAKAMGGGGAVAETSAPEPELVAVSASLTTPATVS
QNGSNHREGRLVVSPRARKLAKELRVDLNNLTGSGPYGRIVAEDVEAAVGKAPQPTTPAI
TPTQPTPPVTPTVAPAKPTPAPAPVVSNAVPGQTVPLTTLQNAVARNMLPSLSVPTFHVG
YTITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHPHINVAVA
VAMDDGGLITPVLQKADQVDIYSLSRNWKSLVEKARAKQLQPEEYNSGTFTLSNLGMFGV
DTFDAILPPGQGSILAIAASRPQVVATADGLFGVRSQMTVNITCDHRIIYGAHAAAFLKD
LAKLIETEPQSLAL
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgagcattcatgaagtatttatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcttgggagaaatcaccaggggataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcggataaggccgatatggatgtggaatccttttatgagggatttctcgcccatatt
atagttcccgctggtgaaaccgcacctgtcggcgcagcgatcgcttacgtagccgaaaca
gaagcagaaatcgaaaccgccaaggctatgggtggtggtggtgctgtggctgaaacatcc
gcacccgaacccgaactagttgccgtatctgcctcattgacaacacccgctacagtttct
caaaatggttccaaccatcgggaaggacggttagtagtttcaccccgcgctcgcaagtta
gccaaagaactccgggttgatttaaataatctcacaggtagtggcccctatggtcgcatc
gtcgccgaagatgtagaagctgccgtgggtaaagcgccacaacctactacccctgctatt
actccaactcaaccgacaccacctgttacccctacagtagcacctgcaaaaccaacacct
gcaccggctccagtggtcagcaatgccgttcctggtcaaacagtaccattaacgactttg
caaaatgccgtagcacggaatatgctacccagtctatctgtacccacattccatgttggt
tacacaattaccaccgatggactagataagctttacaagcaaatcaaatctaaaggtgtg
acaatgacggcgctattagcaaaagctgtagcagtgacattgcaaaaacaccctttatta
aatgccagctattctgatcaaggaattgtgtatcatcctcatatcaacgttgctgttgca
gtagcaatggatgatggtggattaattacaccagtcttgcaaaaagcagatcaggtagat
atctattctttatctcgcaattggaaatctttggtagaaaaagctagagctaaacaacta
caaccagaggaatacaacagtgggacatttaccctctctaacctgggaatgtttggtgta
gatacatttgatgcaattttgccacctggacaaggttcaattttagcgatcgctgcatcc
cgtccgcaagtagtagccacagcagatggtttatttggtgtgcgttcacaaatgacagtt
aatatcacctgtgaccaccgcattatttacggcgctcatgcagcagcattcttgaaagat
ttggcgaaattgattgaaactgaacctcaatctttggcactttaa

DBGET integrated database retrieval system