KEGG   Anabaena cylindrica: Anacy_0663Help
Entry
Anacy_0663        CDS       T02435                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acy  Anabaena cylindrica
Pathway
acy00010  Glycolysis / Gluconeogenesis
acy00020  Citrate cycle (TCA cycle)
acy00620  Pyruvate metabolism
acy01100  Metabolic pathways
acy01110  Biosynthesis of secondary metabolites
acy01120  Microbial metabolism in diverse environments
acy01130  Biosynthesis of antibiotics
acy01200  Carbon metabolism
Module
acy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anacy_0663
   00020 Citrate cycle (TCA cycle)
    Anacy_0663
   00620 Pyruvate metabolism
    Anacy_0663
Enzymes [BR:acy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Anacy_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: AFZ56253
UniProt: K9ZAP0
LinkDB All DBs
Position
799782..801086
Genome map
AA seq 434 aa AA seqDB search
MSIHEVFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGFLAHI
IVPAGETAPVGAAIAYVAETEAEIETAKAMGGGGAVAETSAPEPELVAVSASLTTPATVS
QNGSNHREGRLVVSPRARKLAKELRVDLNNLTGSGPYGRIVAEDVEAAVGKAPQPTTPAI
TPTQPTPPVTPTVAPAKPTPAPAPVVSNAVPGQTVPLTTLQNAVARNMLPSLSVPTFHVG
YTITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHPHINVAVA
VAMDDGGLITPVLQKADQVDIYSLSRNWKSLVEKARAKQLQPEEYNSGTFTLSNLGMFGV
DTFDAILPPGQGSILAIAASRPQVVATADGLFGVRSQMTVNITCDHRIIYGAHAAAFLKD
LAKLIETEPQSLAL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcatgaagtatttatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcttgggagaaatcaccaggggataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcggataaggccgatatggatgtggaatccttttatgagggatttctcgcccatatt
atagttcccgctggtgaaaccgcacctgtcggcgcagcgatcgcttacgtagccgaaaca
gaagcagaaatcgaaaccgccaaggctatgggtggtggtggtgctgtggctgaaacatcc
gcacccgaacccgaactagttgccgtatctgcctcattgacaacacccgctacagtttct
caaaatggttccaaccatcgggaaggacggttagtagtttcaccccgcgctcgcaagtta
gccaaagaactccgggttgatttaaataatctcacaggtagtggcccctatggtcgcatc
gtcgccgaagatgtagaagctgccgtgggtaaagcgccacaacctactacccctgctatt
actccaactcaaccgacaccacctgttacccctacagtagcacctgcaaaaccaacacct
gcaccggctccagtggtcagcaatgccgttcctggtcaaacagtaccattaacgactttg
caaaatgccgtagcacggaatatgctacccagtctatctgtacccacattccatgttggt
tacacaattaccaccgatggactagataagctttacaagcaaatcaaatctaaaggtgtg
acaatgacggcgctattagcaaaagctgtagcagtgacattgcaaaaacaccctttatta
aatgccagctattctgatcaaggaattgtgtatcatcctcatatcaacgttgctgttgca
gtagcaatggatgatggtggattaattacaccagtcttgcaaaaagcagatcaggtagat
atctattctttatctcgcaattggaaatctttggtagaaaaagctagagctaaacaacta
caaccagaggaatacaacagtgggacatttaccctctctaacctgggaatgtttggtgta
gatacatttgatgcaattttgccacctggacaaggttcaattttagcgatcgctgcatcc
cgtccgcaagtagtagccacagcagatggtttatttggtgtgcgttcacaaatgacagtt
aatatcacctgtgaccaccgcattatttacggcgctcatgcagcagcattcttgaaagat
ttggcgaaattgattgaaactgaacctcaatctttggcactttaa

DBGET integrated database retrieval system