KEGG   Anabaena cylindrica: Anacy_0961Help
Entry
Anacy_0961        CDS       T02435                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
acy  Anabaena cylindrica
Pathway
acy00620  Pyruvate metabolism
acy00680  Methane metabolism
acy00710  Carbon fixation in photosynthetic organisms
acy01100  Metabolic pathways
acy01120  Microbial metabolism in diverse environments
acy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Anacy_0961
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Anacy_0961
   00680 Methane metabolism
    Anacy_0961
Enzymes [BR:acy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Anacy_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFZ56536
UniProt: K9ZBG9
LinkDB All DBs
Position
1138999..1142025
Genome map
AA seq 1008 aa AA seqDB search
MGSLLYSSSPAANTYPMSELFLRHRLQVVEELWESVLRQECGQKMVDLLRQLRDLCSPEG
QATHDQASSAVELIEQLNINEAIRAARAFALYFQLINIIEQEYEQKQQLTRYSDTNGTDQ
VNLANIIYSTNQREDDLPVTKSLGSDSPQSWTDTTPIQQKGTFAALFPLLFKLNVPPQQI
QRLISQLDIRLVFTAHPTEIVRHTIRDKQRQVVDLLQHLDSLENRSGGYPWEAAEVRERL
MEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYKRLKYSLAQTFPWLEPP
STNFCSFGSWVGSDRDGNPSVTPEVTWKTACYQRKMVLERYIQSVTQLIELLSVSMHWSD
VLPDLLESLELDQSTMSDVYDALALRYRQEPYRLKLAYVLRRLENTRDRNLALYKRETPT
NEDAPMYRSGAEFLAELRLIHHNLTETGLGCRALETLICQVEIFDFNLTQLDIRQESSRH
ADALNEILEYLQVLPQPYNELSEEQKVAWLTGELRTRRPLIPSELPFSEKTNDVIETFRV
LRSLQQEFGINICQTYIISMCREVSDVLEVLLLAKEARLFDPAIAVGSIRVVPLFETVED
LQRSRSVMRQLFELPLYRAFLAGGYEAIKPENSSPSPTLNPNLQEVMLGYSDSNKDSGFL
SSNWEIHKAQKSLQKIAEEYGLHLRIFHGRGGSVGRGGGPAYEAILAQPGHSINGRIKIT
EQGEVLASKYSLLDLALYHVETITSAVIQASLLRTGFDDIEPWNEIMEELSMRSRQHYRA
LIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLSSLRAIPWVFSWTQTRFLLP
SWYGIGTALQEFLNAEPEEHLKLLRYFYVKWPFFKMVISKAEMTLAKVDIEMARHYVDEL
SSPEDKPRFDKVFEQIASEFYLTRNLVLNITGHQRLLDGDPTLQRSVQLRNGTIVPLGFI
QVSLLKRLRQYKNTSTSGIIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccttttatactcttcatcgccagcagcgaatacataccccatgtcggaatta
ttcttgcgtcatcgtctacaggtagtagaggaattgtgggagtcggttcttcggcaagaa
tgcggacaaaaaatggtagatctattgcgtcaattgcgcgatttgtgttctcctgaagga
caagctacccatgaccaggcttcctccgcagtcgaattgattgaacaattaaatatcaac
gaggccattcgtgctgctcgtgcctttgctctgtattttcagttaattaacatcattgag
caggaatacgaacaaaagcagcaacttactcgctattctgatacaaacggtacagatcag
gtaaatctcgccaatattatttattcaaccaaccaacgagaagatgacctaccagttacc
aagtcattaggatcagactcaccacaaagttggacagacaccacgccaattcaacaaaag
ggtacatttgccgctttatttccgctgttattcaaactgaatgttccaccccagcaaatt
caacgcctcatttctcaactggatatccgcttagtcttcactgcacaccccacggaaatt
gtccgtcatactatccgcgataaacagcggcaggtagttgaccttttacaacacctagat
agcttagaaaatcgctctgggggctatccttgggaggcagccgaggtgagagagcgattg
atggaagaaattcgtctgtggtggcggacagatgagctacatcaatttaagcccacggtt
ttagatgaggtagattatgctctgcactacttccaagaagtgttatttgatggcattccg
cagttgtataaacgcctcaaatattctctagcacaaacatttccttggctagaaccacca
agtacaaatttctgctcctttggttcttgggtaggttcagaccgagatggaaatccgtcg
gtgacaccggaagttacttggaagactgcttgttatcagcggaaaatggtcttagagcga
tatattcagtcggtgacgcaactgattgagttattgagtgtgtccatgcactggagtgat
gtattaccagatttgctggaatctctagagttagatcaatcaacgatgagtgatgtctat
gatgctttagctctgcgttatcgccaagaaccttatcggttaaaactggcttatgtgttg
agacggctagaaaatacacgcgatcgcaatttggctttatataaacgggaaacgcccaca
aatgaagatgcaccaatgtaccgttccggggcagagtttttagctgaattgcgattaatt
caccacaatttgactgaaacgggtttaggctgtcgagctttagaaaccctaatttgtcaa
gtggaaatttttgactttaacctcacccagctagatattcgccaagaatcatcccgtcat
gctgatgcgctgaatgagattcttgaatacttgcaagttttaccccaaccctataacgaa
ctttcagaagagcagaaagtggcttggttaaccggggaattacgaacaagacggccatta
attcccagtgaattgccattttcggaaaaaaccaacgatgtcattgaaactttccgggtt
ttgcgatcgctacaacaagaatttggcatcaacatctgtcagacttacatcatcagtatg
tgccgcgaagtcagcgatgttttagaagttttactcttagccaaagaagcgagattattt
gatcctgcgatcgcagtaggatcaattagagtagtaccgctatttgagactgtagaagac
ttacaacgctccagaagcgtcatgcggcaactgtttgaacttcccctttatcgcgccttc
ttagcaggtggctatgaagcaattaaacccgaaaattcttctccatctcccaccctcaac
cccaatttgcaagaagtcatgctggggtattctgacagcaacaaagactccggtttctta
agtagcaactgggaaattcacaaagcgcaaaaatcactccagaaaatcgctgaagaatac
ggcttacatctgcggatttttcacggtagaggtggatctgtgggacggggtggtggccca
gcttatgaggcgattttagctcaaccaggtcacagtatcaacggccgcattaagattacc
gaacaaggagaagttttagcttctaaatattccttgttggatttggctttgtaccacgta
gaaaccattaccagtgcggttattcaagctagtttactgcggactggatttgatgatatt
gaaccatggaatgagatcatggaagagttgtcaatgcgatcgcgtcagcattatcgcgcc
ctcatttacgaacaacctgattttattgacttcttccaccaagtcacccccattgaagaa
atcagccaactgcaaattagctcccgtccagcgcgaagaccatctggtaaaaaagactta
agcagcttacgagccattccttgggtatttagttggacacaaaccagatttttgttacct
tcttggtacggtatcggcacagccttacaagaatttttaaacgccgaaccagaagaacac
ctcaaattgctacgctacttttatgtcaaatggcctttcttcaaaatggtaatttccaaa
gccgaaatgaccttagccaaagtagatattgaaatggcacgtcattacgttgatgaatta
tccagcccagaagacaaaccccggtttgacaaagtatttgagcaaattgccagcgaattt
tatctcaccagaaatttagtcttaaacatcaccggacaccagcgacttttagatggtgat
ccaactttacagcgttcagtacagttaagaaatgggacaattgtacctttaggatttatc
caagtttctctactcaagcgtctacggcagtacaaaaacaccagcacctctggaataatt
cactcccgttacagcaaaggtgagttactcagaggagcattgttaaccattaacggtatt
gctgcgggaatgagaaatacaggctga

DBGET integrated database retrieval system