KEGG   Anabaena cylindrica: Anacy_1312
Entry
Anacy_1312        CDS       T02435                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acy  Anabaena cylindrica
Pathway
acy00480  Glutathione metabolism
acy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Anacy_1312
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acy02000]
    Anacy_1312
Enzymes [BR:acy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Anacy_1312
Transporters [BR:acy02000]
 Other transporters
  Pores ion channels [TC:1]
   Anacy_1312
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C Glutaredoxin GST_C_5
Other DBs
NCBI-ProteinID: AFZ56836
UniProt: K9ZCD8
LinkDB
Position
complement(1568261..1568932)
AA seq 223 aa
MADIKIYSAVVCPYAHRTRLVLQEKGIDFDLIEIDLQNKPEGFTRVSPYGKVPAITHGEN
RVWESAVINEYLDEVFPNPPLLPSNPIAKAQARIWIDFANTRLVPAFSTLLRSPDFQKQE
EAKQELYKHLEFIENEGLGKLSGDGPYWFGESISLVDFTFFPWFERWAALKHYRSFGIPA
EFTRVKQWKHALKERESVKAIAHSKEFYIERYAKFATPVPVAA
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctgacattaagatttatagtgcggttgtttgtccttatgctcaccgtacccgcttg
gtacttcaagaaaagggtattgatttcgatttgattgaaattgatttgcagaataaacca
gaaggttttacaagagtttctccttatggaaaagtacctgcaattactcatggggaaaat
cgagtttgggaatcagcagttattaacgaatatctggatgaagtatttcccaatccaccg
cttttacctagcaaccctattgcaaaagctcaggctcggatttggatagattttgccaat
actagattagttcctgctttttctacgctgttacgtagtccagatttccaaaaacaagaa
gaagcgaaacaagaactctacaaacatctagaatttattgaaaatgaaggtttagggaaa
ctttctggagatggtccctactggtttggtgaatctatcagtttggttgattttaccttt
ttcccctggtttgaaagatgggctgcacttaagcattatcgtagctttggtatccctgct
gaattcactcgtgtgaaacagtggaaacacgcgctcaaagaacgtgaatcagtgaaagcg
atcgctcactccaaagaattttatattgagcgatatgctaaatttgctactcccgtcccc
gtcgctgcttag

DBGET integrated database retrieval system