KEGG   Anabaena cylindrica: Anacy_2243Help
Entry
Anacy_2243        CDS       T02435                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
acy  Anabaena cylindrica
Pathway
acy00473  D-Alanine metabolism
acy00550  Peptidoglycan biosynthesis
acy01100  Metabolic pathways
acy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Anacy_2243
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Anacy_2243
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Anacy_2243
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acy01011]
    Anacy_2243
Enzymes [BR:acy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Anacy_2243
Peptidoglycan biosynthesis and degradation proteins [BR:acy01011]
 Precursor biosynthesis
  Amino acid ligase
   Anacy_2243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 Pneumo_ncap
Motif
Other DBs
NCBI-ProteinID: AFZ57702
UniProt: K9ZGN6
LinkDB All DBs
Position
2525130..2526194
Genome map
AA seq 354 aa AA seqDB search
MSKLRVGLLFGGRSGEHEVSIISARAIANALNAEENSHKYEIVPFYIQKDGFWQAGEVAQ
QVLSSGVARENLAVTPNLWEFPPQTAEIDLWFPILHGPNGEDGTIQGLLTLMQVPYVGSG
VLGSATGMDKIGMKTAFAQAGLPQVKYKAITRAQVWSNPCIFPKLCDEIELTLGYPCFVK
PANLGSSVGIAKVRSRQELELALDNAATYDRRIIVEAGVVAREVECAVLGNDNPKASVIG
EITFDSDFYDYETKYTQGKADLFIPAHLTDSVVQQIQEMALKAFLTVDAAGLARVDFFYI
EATGEILINEINTLPGFTATSMYPQLWANTGISFPKLVDELIQLAIERHLKSAE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagctgcgggtgggattgctgtttggtggacgttctggagaacatgaagtttca
ataatttctgcacgagcgatcgctaatgctttaaatgcagaggaaaatagtcacaagtac
gaaatagtgcctttctacatccaaaaggatggtttttggcaagctggggaagttgcacag
caagttttatcatctggtgtggctagagaaaatctagccgtaacccctaatttatgggag
tttccaccacaaacagcagaaattgatttgtggtttcctattctccacggccccaatggt
gaagatggtacgattcaaggtttactcactttaatgcaagtcccttatgtgggttctggg
gtgttaggttcggctacgggaatggataaaatcggtatgaaaaccgcttttgctcaagct
ggactaccccaggtaaaatataaagcgataactagggcgcaagtttggtcaaatccttgt
atttttccgaaattatgtgatgaaattgaactaactttaggctatccctgtttcgttaaa
ccggctaatttgggttcgtcggtaggaattgcgaaagtgcgatcgcgccaagagttagaa
ttagctttagataatgccgcaacctatgatagacgcattattgtcgaagccggagttgtc
gctagagaagtagaatgtgccgttttaggtaacgataatcccaaagcatctgttattggt
gagattacgtttgatagtgatttttacgattacgaaactaaatatacccaaggtaaagcc
gatttatttattcccgcacatctaacagattcagtagttcagcaaattcaagaaatggca
ttaaaagcctttttaactgttgacgctgctggtttagcacgggtagactttttctatatc
gaagctaccggagaaattttaattaacgaaattaatactttaccagggttcacagccaca
agtatgtatcctcaactttgggcaaatactggtatttcttttcccaaattagtagacgaa
ttaattcaattagctattgaaagacatttaaagagtgctgagtaa

DBGET integrated database retrieval system