KEGG   Anabaena cylindrica: Anacy_2541Help
Entry
Anacy_2541        CDS       T02435                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
acy  Anabaena cylindrica
Pathway
acy00500  Starch and sucrose metabolism
acy01100  Metabolic pathways
acy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Anacy_2541
Enzymes [BR:acy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Anacy_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AFZ57985
UniProt: K9ZI08
LinkDB All DBs
Position
2882530..2885094
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPQRLEPLRKLAYNLHFDWNVESKDLFRRLDTDLWESSRHNPVLMLGT
ISQARLLEVVEDEGFLAQMDRAARQLEDYLQERTWYHKQRGQNPKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYPINDFYNM
PLHLERNPDGSELRIEVDYPGRKVYARVWRVQVGTVPLYMLDTNIEPNKAYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYDVTAYHMNEGHAAFSALERIRVLIQEEGLSYAQ
AKQVVSSSNIFTTHTPVPAGIDLFAPDKVLYYLGYYADIFGLPKEQFLGLGRENTGDLSG
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWKKVPVEEVPIAAITNGVHARSCVAKS
TQELYDRYLGPNWSSAPPDNQLWERMDSIPDEELWRNHERCRLDMVLYVREHLVKHLRDR
GASASEIAQAQEVLDPNVLTIGFARRFATYKRATLWMRDLDRIKRILLSNKHRKVQFVIA
GKAHPKDIPGKELIRDINHFIHEQNLEKQVVFVPNYDIHIARLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGENYEDPNYQDEVEANALYELL
EKEVVPLFYDHRDEDGLPRPWVAKMKDAIRLNCPFFNTARMVREYAQRAYFPASDRYHTL
TVDNYAPAKELAAWKAKLGQQWFNIKIKDIDVSAASDIEVNQTVAVKAKVDLATLKKDDV
RVELYQGSIDANGDIVNAVPVVMDYQGEDNQGLSIYTVDITYTTSGLQGLSLRVLPQNPY
LSSPYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgcacgtttaacgtttcaccttcactaccgcagcgactagaacccttg
cggaaactggcatacaatctgcactttgattggaatgttgagagtaaagacttatttcgt
cgcttagatactgacttgtgggaatcaagtcggcataacccagtgttgatgctgggtact
attagccaagcacggctattagaagtcgtagaagatgaaggcttcttagcgcaaatggat
cgggctgcgcgtcaattagaagattatttgcaagaacggacttggtatcacaaacagcgc
ggtcagaacccaaaagaatgctacgcttatttttcggctgagtttggactagtagattgt
ctacccgtctattctggcggtttgggtgtactggcaggagatcacctcaagtctgctagt
gatttgggattacctctcgttggtgtgggtttactctaccaacaaggttactttgcccag
tatctcaatgctgatggttggcagcaagaacgctaccccatcaatgatttttataatatg
cctttgcatttggaacgtaatcctgatggctcagagctacggattgaggtagattatcca
ggacgcaaggtatacgctagggtgtggcgtgtacaagtgggaacagtgccactgtatatg
ctggataccaatattgaaccgaacaaggcctatgaccacgacattacagatcagctgtat
ggtggtgatatagatatgcgtatccaccaggaaattatgctggggattggtggtgtgcaa
atgttgaaagctttgggctatgatgtcaccgcttaccacatgaatgaaggtcatgcagct
ttttctgccttagaacgtattcgcgttttgattcaagaagaaggcttaagttatgctcaa
gctaaacaagtggtgtcttctagtaatatttttactacccacactcctgtaccagcgggc
attgatttatttgcgcccgacaaagttttgtattatttgggttactacgcagatatcttt
ggtttacctaaagagcaatttttaggattgggaagggaaaatactggagatttatctggg
cctttcagtatggcggtgttggcactgaagatggcaacattttctaatggtgtggcacag
ctacatggtgtggtatcgcggcaaatgttccaaggtttgtggaaaaaagttcctgtggag
gaagtgccgatcgcagcaataactaatggggttcatgctcgcagttgtgttgcgaagtct
actcaggagttgtacgatcgctatcttggcccaaattggtcatcggcaccaccagataat
cagttgtgggaacggatggattctattcccgatgaggagttatggcgcaatcacgaacgc
tgccgtttggacatggttctctatgtgcgggagcatttggtgaagcatttacgcgatcgc
ggtgcttcagcttcagaaatcgcccaagctcaagaagtacttgatcctaacgttttaact
attggctttgcccgtcgctttgctacctacaaacgcgctactttatggatgcgtgatttg
gacagaatcaaacggattttgttgagtaacaaacaccggaaagtgcagtttgtgattgct
gggaaagcacaccccaaagatatccccggtaaagaattgattcgggatatcaatcacttc
atccacgaacaaaacttagaaaaacaggtggtgtttgttcctaactacgatattcacatt
gcccgcttgatggttgcaggttgtgatatctggttaaataccccccgtcgtccccgtgaa
gcttctggtactagcggcatgaaggcagctatgaatggcttgccaaatttaagcgtactc
gatggctggtgggatgaggctgattatgtccgcaccggttgggcaattggacatggtgaa
aattacgaagatcctaattatcaggatgaggtagaagccaacgctctctatgagttatta
gagaaagaagttgtacctctattctatgaccatcgtgatgaagatggtttaccccgtcct
tgggtagctaaaatgaaagatgcaattcgtttgaattgtcctttctttaatacagcccgc
atggtgcgggagtatgcacaacgagcttattttccagcaagcgatcgctatcacaccctc
accgttgataactacgccccagcgaaagaattagcagcctggaaagcaaaactaggtcaa
cagtggtttaacatcaaaatcaaagatattgatgtatccgcagcatcggatattgaagtt
aatcaaaccgttgctgttaaagccaaagttgatttagcaactttgaaaaaagatgacgtg
cgtgtggaattataccaaggttccattgatgcaaacggcgatattgttaacgctgtacca
gtggtaatggattatcaaggagaagataatcaagggttgagtatttacacagtagatatc
acctacaccacatctggtttacaaggcttatctttgcgtgtattaccacaaaatccatac
ctttctagtccttatgaacccaggctaatcgcttgggctgaatag

DBGET integrated database retrieval system