KEGG   Anabaena cylindrica: Anacy_4460Help
Entry
Anacy_4460        CDS       T02435                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K11951  bicarbonate transport system permease protein
Organism
acy  Anabaena cylindrica
Pathway
acy02010  ABC transporters
Module
acy_M00321  Bicarbonate transport system
Brite
KEGG Orthology (KO) [BR:acy00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Anacy_4460
Transporters [BR:acy02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Bicarbonate transporter [MD:M00321] [OT]
    Anacy_4460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFZ59818
UniProt: K9ZKQ5
LinkDB All DBs
Position
5050027..5050866
Genome map
AA seq 279 aa AA seqDB search
MTVAQKRSTSPKFDNKFLSSLQKQFPELLPPVIAILIFLTIWQLFSWTPGATLPGPIKVI
QDTWILILYPFYDKGGTDKGLFWQILASLQRVAISYTLAAIVGIGLGVLIGVNQTMAKAL
DPLFQLLRTVPPLAWVPISLAALRQNEPAALFVIFITSLWPILINTAVGVTQIPQDYNNV
AKVLQLSKKEYFFNILIPSALPYIFTGLRIAIGLAWLAIIAAEIVMSGIVGIGFFIWDAY
QNNNVSEVILALVYIGVVGLILDKLMAALQNWILPTEQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacagtagcccaaaaacgttccacaagtcctaaatttgataataaatttttatcaagt
ttgcaaaagcaatttcctgaacttctccctccagttattgcgatcctcatcttcttaact
atttggcaattattctcttggactccaggggcaacactaccagggcccatcaaggttatt
caagacacttggatcttgattttgtatcccttctatgacaaaggaggcacagataaaggg
ctgttctggcaaattttagctagtttacaaagggtagctattagctatacattagcggca
attgtcggtattggcttgggtgttttgattggtgtaaatcaaactatggcaaaggcttta
gatcccctatttcagttactaagaactgtaccacctttggcttgggttcccatttcctta
gcagctttacgccaaaacgaaccagcagcattattcgttattttcatcacctcactttgg
ccaattctcattaacactgcggtgggtgtaactcaaatcccccaagattacaataacgtt
gctaaagttctgcaactttctaaaaaagagtatttctttaacatcttaattccttcagca
ttaccttacattttcacaggattaagaattgccattggtttggcttggttagcgattatc
gcagcagaaatagtcatgtccggtattgtcggaattggcttttttatctgggatgcttat
caaaataacaacgtcagtgaagttattttagctctagtttatatcggtgttgttggtcta
atcctagataaactcatggcggcgctacaaaactggattttacctactgagcaaaaatag

DBGET integrated database retrieval system