KEGG   Anser cygnoides domesticus (swan goose): 106030622Help
Entry
106030622         CDS       T04896                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106030622
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acyg01001]
    106030622
Enzymes [BR:acyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106030622
Protein kinases [BR:acyg01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   106030622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PX Kinase-like Pkinase_C FTA2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 106030622
NCBI-ProteinID: XP_013027972
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MDLKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRNEWFVLRRYAEFDKLYNTLKKQFP
TMNLKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRQPELCNHPDVRAFLQMDNPKHQS
DPSEDEDERSNQKLNSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGK
YYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFINGG
ELFFHLQRERSFPEHRARFYAAEIASALGYLHSINIVYRDLKPENILLDSLGHVVLTDFG
LCKEGIASSETTATFCGTPEYLAPEVIKKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDV
AEMYENILHKPLVLRPGISLTAWSILEELLEKDRQSRLGAREDFLEIQKHPFFESLSWTD
LLQKKIPPPFNPNVVGPDDIGNFDAVFTEEMVPYSVCISSDYNIVNASVLEADDAFVGFS
YAPPSEDMFS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatcttaaagaaagctgcccaagcgttagcattcccagctctgacgaacacagagag
aagaagaaaagatttactgtttacaaagtgttggtctcggttggcagaaatgaatggttc
gtcctcagacggtatgcggagtttgataagctctacaatacgctaaagaagcaatttcca
actatgaacctgaagattccagctaaaagaatattcggagataattttgatcccgatttt
attaaacagagaagagcaggactgaatgaattcattcaaaacttagttagacagccagag
ctatgcaaccacccagatgtcagagcatttcttcagatggataaccccaaacaccagtcg
gatccatcagaagatgaagatgaaaggagtaatcagaagttaaattctacctcacagaat
atcaacttgggaccatctggaaatcctcatgctaaaccaacagactttgatttcctgaaa
gttattgggaaaggaagctttggcaaggttcttcttgccaaaagaaaactggatgggaaa
tattacgctgtcaaagtgctgcagaaaaagattgttcttaacaggaaagagcaaaaacat
attatggctgaacgtaacgtgcttctgaaaaatgtgaaacatccatttttagtgggatta
cattactcattccaaacaacagaaaagctttactttgttctggatttcattaatggagga
gagctgttctttcacttacaaagagaacgttcctttcctgagcacagagccagattttat
gctgctgaaatcgccagtgcactgggctacttacactccataaatatagtgtacagggat
ttaaagccagaaaacattctcctagattcactaggtcacgttgtgttgacagactttgga
ctttgtaaagaagggattgcaagttctgaaactactgcaactttctgtgggacaccagaa
taccttgcaccagaagttattaaaaagcagccctatgacaacacagtagactggtggtgc
cttggtgcagttctttatgaaatgctttatgggctgcctcctttttactgccgtgatgtt
gctgagatgtatgagaatattcttcataagcccctggttctgcgtccaggaatcagtctc
acagcctggtctattctggaagaacttttggagaaagatcggcaaagcagactcggagca
agggaagactttcttgaaattcaaaagcacccattctttgaatctctcagctggactgac
ctccttcagaagaagattccgccaccatttaatcctaacgtggttggcccagatgatatt
gggaattttgatgccgtgtttacagaagaaatggtcccatactcagtttgcatttcttct
gattacaacattgttaatgccagtgtcctagaggcagatgatgcatttgttggattttct
tatgcaccaccttctgaagatatgttttcctag

DBGET integrated database retrieval system