KEGG   Anser cygnoides domesticus (swan goose): 106030788
Entry
106030788         CDS       T04896                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04010  MAPK signaling pathway
acyg04020  Calcium signaling pathway
acyg04144  Endocytosis
acyg04510  Focal adhesion
acyg04540  Gap junction
acyg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106030788 (PDGFRA)
   04020 Calcium signaling pathway
    106030788 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106030788 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106030788 (PDGFRA)
   04540 Gap junction
    106030788 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106030788 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acyg01001]
    106030788 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:acyg04090]
    106030788 (PDGFRA)
Enzymes [BR:acyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106030788 (PDGFRA)
Protein kinases [BR:acyg01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   106030788 (PDGFRA)
CD molecules [BR:acyg04090]
 Proteins
  106030788 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 106030788
NCBI-ProteinID: XP_013028223
LinkDB
Position
Unknown
AA seq 1106 aa
MLDNDHDEGIIQMRQLSVAMGTSPRTFLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQL
NSNFTLKCSGDSEVSWQYPVTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYY
NHTQVEDGEVEGKDIYIYVPDPDMPFVPSIPEDQFILVEEGDPTIIPCRTSDPNAQVTLI
NSLDKAVYAFYDNKQGFIGNFLAGSYTCKTTVKGVEFKSDVFLIYILRATSQLPVEIEAL
KTVYKTGETIVVTCVVFDNEVVNLQWNYPGKVKEKGVIKLDDIKVPSQKLVYTLTIPEAS
VKDTGDYECTARHATKEVKENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQA
YPAPKMYWLKDNVTLIENLTEIVTSSSRVQETRFQSILKLIRAKEEDSGYYTLVAENEDE
IKRYTFSLLIQVPALILDLVDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTS
WTLLTNNISDIHMEAHLDEKNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTL
RSELTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLP
YDSRWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQAL
MSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKP
KKDLDIFGMNPADESTRSYVILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSV
YDRPASYKKKSLSESEVKNLLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAA
RNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSY
GILLWEIFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRP
SFYHLSEIVESLLPGEYKKSYEKIHLDFLKSDHPAVTRMRGDCDNTYIGVTYKNEDKLKD
RESGFDEQRLSADSGYIIPLPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKRE
DETIEDIDMMDDIGIDSSDLVEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgctcgataatgatcacgacgaaggcattattcaaatgaggcagttgtcggtagcgatg
ggtacttccccaaggacattcctgatcctgggatgtttcctcacaggcccgttcctaaca
ttttgccagcttcctctgccgactattgttcccaacagaaatgaaatggttgtacagctc
aattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtacccagtg
accgagggaagccacaggatagacatcagacatgaagagaacaacagtggcctcttcgtg
acagtgctggaagtaggaaatgcctcagctgctcacacgggcctgtatgtttgctattac
aatcacactcaagtggaggatggggaagtggaggggaaggacatctacatctatgtgcct
gacccagacatgccttttgttccttccataccagaagaccagttcatcctagtagaagaa
ggtgatcccaccattatcccatgtcggacaagtgacccaaatgctcaagtgactttaatt
aacagtttagataaggctgtgtatgctttctatgacaacaagcaaggcttcataggaaac
ttccttgcgggatcatacacttgcaaaacaacagttaaaggtgtggagttcaagtctgat
gtgttcctcatctatattttaagagctacttcacagctgccagttgaaattgaagctctt
aaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaacgag
gtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtgtgataaaactt
gatgatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggcatca
gtgaaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaaggaa
aataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcagttt
agccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtcgatgtgcaggca
tacccagctccaaaaatgtactggttgaaggataatgtgactctgattgaaaatcttact
gagattgttactagttcaagcagagtccaggaaacaaggtttcaaagtatactaaaattg
atccgggccaaggaagaagacagtggatattataccttggttgctgaaaatgaagatgag
attaaaagatacaccttctcactgctaatacaagttccagccttgatcttagaccttgtg
gatgaccaccatggctctgcagggggacagacagtgaggtgcttggcagaggggaccccg
cttcctgatgtggaatggctggtttgcaaggacattaaaaaatgcagcaatgacacttca
tggactcttctgactaataatatctctgatatacacatggaagcccatctggacgagaag
aacatggtggaaagccaggtgaccttccagaaagtagaggaaaccctggctgtgcgatgt
gtggcaagaaacgacctcggtgctgttactcgggaactgaaacttgtggctcccaccttg
cgatcagaactgacggtggctgctgcagtcttagtactgttagtgattgtgataatttca
ctgattgtcctggtcatcatctggaagcagaagccaaggtatgagataagatggagagtc
attgagtctatcagccccgacggccatgaatacatttatgtggacccaatgcaactgcct
tatgactccagatgggagtttcctcgagacgggttagtgcttggtcgaatccttggttct
ggtgcatttggaaaagtggttgaagggactgcatatggattgagccgttctcaaccagtg
atgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggcactc
atgtctgaactgaagataatgacacatcttgggccccacctgaatattgtgaacctgctt
ggagcttgtacaaagtcaggtcctatttacatcatcactgaatactgcttttatggtgat
ttggtgaactatctgcacaagaacagggacaatttcctgagccgccacccagagaagccc
aagaaagatttggatatctttgggatgaacccagctgatgaaagcacaagaagttatgtg
attttatcatttgaaaacactggagaatacatggacatgaaacaagctgatacaacccag
tacgtgccaatgctggaaaggaaggagggatctaaatattctgatattcagagatctgtg
tatgatcggccggcttcatataagaagaaatctctgtcagaatcagaagtcaaaaacctt
ctttcagatgacagttcagagggcctcagcctattggatttgctgagcttcacctaccag
gttgcacggggaatggaattcttggcttctaaaaattgcgtacaccgtgacttggcagct
cgtaatgtccttctggctcaaggaaaaatcgtgaagatctgtgactttgggttggctaga
gacatcatgcatgattccaactatgtctccaagggcagcactttcctcccagtaaaatgg
atggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtcttat
ggcattctgctgtgggaaatattttctcttggtggcacaccgtatcctggcatgatggtt
gactctactttctacaataagataaagagtggctaccgaatggcaaaacccgatcatgct
accaatgaagtgtatgagatcatggtgaaatgctggaacagtgaacctgagaaaagaccc
tctttttaccacttgagtgaaattgtggagagcttgttgcctggagagtacaaaaagagc
tatgagaagattcacctggacttcctgaaaagtgatcacccagctgtcacacgcatgaga
ggggactgtgacaatacttacattggtgtcacctacaagaacgaagacaagttaaaggac
agggagagtggatttgatgagcagaggctgagtgctgacagcgggtacatcatccccctg
cctgatattgaccctgtttctgaagatgagcttggcaagaggaaccggcacagttcccag
acatctgaagaaagtgccattgaaactggttccagtagctctacttttatcaagagagag
gatgagaccattgaggacattgacatgatggatgacatcgggattgactcctcagacctg
gtagaggacagcttcctgtaa

DBGET integrated database retrieval system