KEGG   Anser cygnoides domesticus (swan goose): 106030933
Entry
106030933         CDS       T04896                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04010  MAPK signaling pathway
acyg04020  Calcium signaling pathway
acyg04260  Cardiac muscle contraction
acyg04261  Adrenergic signaling in cardiomyocytes
acyg04270  Vascular smooth muscle contraction
acyg04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106030933 (CACNA1C)
   04020 Calcium signaling pathway
    106030933 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106030933 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106030933 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    106030933 (CACNA1C)
   04270 Vascular smooth muscle contraction
    106030933 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acyg04040]
    106030933 (CACNA1C)
Ion channels [BR:acyg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106030933 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 106030933
NCBI-ProteinID: XP_013028442
LinkDB
Position
Unknown
AA seq 2218 aa
MFQAFVRQAYQPLSSHQQGEPETKYKGKLVHETQLNCFYIKPGGSNYGSPRPAHANMNAN
AAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKKQG
TTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSN
ATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILE
QATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIAL
LVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTEC
KAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNMSMPTSETESVNTDNVPGADIEGENCGARLAHRISKSKFSRYWRRWNRF
CRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEML
LKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNF
PQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNCILLNVFLAIA
VDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKTAVEEETKEEKIELKSITAD
GESPPATKINMDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAV
PMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQI
LFYFDIVFTVIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNIL
DLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNI
VIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTAAECRGYYITYKDGEVNQPMIQPRSWE
NSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIII
IAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKV
WYVVNSTYFEYLMFVLIRSWVLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFK
PKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPA
EHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALL
IVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACL
PDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDW
SILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSM
NMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVP
PAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIR
RAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQR
PLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSYPS
TVSTVEGHGAPLSPTIRVQEAPWKLPSKKTHYYETLGRSSSRDSQLAIVCQEEVSQDETY
DENLNEDIEYCSEPSLLSTEMLSYQDDENRQLTPPENNKGEDTRHSPKKGFLRSSALGRR
ASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTMFSRLCATPP
ATPCSRGWPQQAIPTLRLEGAESSEKLNSSFPSVHCSSGFPDGTGCSSPRRARPVSLTVP
SQSAGSSRQFHGSASSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAAD
NILNGNSKQSPNGNLLPFVNCRDAGQDSAGEEEEEVQSPDCRKSQEELKDSRIYISSL
NT seq 6657 nt   +upstreamnt  +downstreamnt
atgtttcaagcctttgttcggcaagcatatcaaccactatccagccaccagcaaggggaa
cctgaaacgaagtataaggggaagctggtgcatgaaactcagcttaactgcttctacatc
aaacctggaggttccaactatgggagtccccgtccagctcatgccaacatgaatgccaat
gcagctgcagggcttgccccagagcatatccctactccaggggcagctctgtcctggcaa
gctgcaattgatgctgccaggcaagccaaattgatgggtagtgctggcaatgcaacaata
tccacagctagctccacgcagagaaaacggcagcagtacgggaaacagaaaaaacagggt
accaccacagctacacgtcctccccgggcactgctgtgtttaacactgaaaaatcccatc
cggagggcatgcatcagcatcgtcgaatggaaaccatttgaaataattattttactgact
atttttgccaattgtgtggccttagctatctatatcccctttccagaagatgattccaat
gccaccaattccaatctggaacgagtggaatatctctttctcataatttttacagtggaa
gcatttttaaaagtaatagcatatggactcctctttcaccccaacgcttacctccgcaat
ggctggaatttactagattttataatcgtggtcgtagggctttttagtgcaattttagaa
caagcaaccaaagcagatggggggaattcaataggaggaaaaggtgccggatttgatgtt
aaagcactgcgggctttccgagtattgcgtccgttacggctggtgtctggagttcctagt
ctccaggtggttttaaactcaattatcaaggccatggtccctttgttgcatattgccctg
ctggtgctgtttgtcattattatctatgccatcattggactggagttattcatgggaaag
atgcataagacctgctaccatgtgcaaggggggctgatagatacacccgcagaagatgat
ccgtctccctgtgccccccagtctgcacatgggcggcagtgtcagaatggcaccgaatgc
aaagcaggctgggaaggacccaagcacggcattacgaactttgacaattttgcttttgcc
atgctgacggtgtttcagtgcatcacgatggagggctggacagatgtactctactgggtc
aatgatgccataggaagggactggccctggatctattttgttacactaatcatcataggg
tcattttttgtacttaacttggttctcggtgtacttagcggggagttttccaaagaaaga
gagaaggctaaggctcgtggtgatttccagaagttacgggaaaagcaacagctggaggag
gatttgaagggatatttagactggataactcaagctgaagacattgacccagaaaatgaa
gatgaaggcatggatgaggagaagcctcgaaacatgagcatgcccaccagtgagaccgag
tccgtgaacacagacaacgtccctggagcagatattgaaggcgaaaactgcggtgctagg
ctagcgcatcggatctccaaatctaagtttagtcgctactggcgccggtggaatcgattc
tgcagaagaaagtgccgtgccgctgtcaagtccaatgttttctactggttggtgatcttc
ctcgtgtttcttaacacccttactattgcctctgaacactacaaccagcctgactggctc
actgaggttcaagacactgccaataaggtgctgctagctcttttcacggcagagatgctg
ctgaagatgtacagccttggtctacaggcctattttgtgtccctcttcaaccgctttgac
tgtttcatcgtgtgtggaggaatcctggaaacgattctggttgagacaaagatcatgtca
ccactgggcatttcagtgttgagatgtgttcggctattaagaatatttaaaatcacaaga
tattggaactccctgagcaaccttgtggcttcactcctgaattcagttcgctccattgct
tccctgttgctgctcctcttcctcttcattatcatcttctcactcctggggatgcagctc
tttgggggcaagtttaactttgacgaaatgcagaccaggaggagtacatttgacaacttc
ccccagtccctcctcactgtgtttcagatcctgactggggaggactggaattcggtgatg
tatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttac
ttcatcatcctcttcatctgtggaaactgtatcctgctgaatgtatttttggctattgct
gtggacaaccttgctgatgccgagagtttaacatctgcacaaaaagaggaggaagaggaa
aaagaaaggaaaaagttagctaggactgctagtcctgaaaagaaacaggagatagaaaaa
acagctgtggaggaggagacaaaggaggagaaaattgagctgaaatcaatcactgctgat
ggagaatccccgcctgctaccaagatcaacatggatgattatcagccaaatgaaaacgaa
gaaaagagcccatatcccacaacagaagcaccagcagaggaagatgaggaagaacctgag
atgcctgttggccctcgacctcgcccaatgtctgaactgcacctcaaggaaaaggctgtg
cccatgcctgatgccagtgcttttttcatcttcagtcctaacaacaggtttcgtgtccac
tgccatcgaatcgttaatgataacattttcaccaacctgatcctatttttcatcttgctc
agcagcatctccctggcagctgaggaccccgtccgacacctctcctttaggaaccaaatt
ctcttttattttgatatagtttttactgtcattttcaccattgaaattgctctgaagatc
ctaggcaatgcagactatgtcttcactagtatctttacattagaaattattcttaagatg
accgcatacggagctttcctccataagggctccttctgcagaaactatttcaacatctta
gacctgctggtggtcagcgtttctctcatctcctttgggatccagtccagtgccatcaat
gtggtgaagatcctgcgtgttttgcgagtacttagaccactgagggccatcaacagagcc
aaagggctaaagcatgtggtccagtgtgtgtttgtcgccatccgaaccatcggcaacatt
gtgattgtcacaactttgctgcagttcatgtttgcctgcattggagttcagttgttcaag
ggcaaactctatagctgcactgatagctccaagcagacagcagcagaatgcagagggtac
tacattacatacaaggatggtgaggtcaaccagccaatgatccagccccggagctgggag
aacagcaagtttgactttgacaacgtcttgactgccatgatggccctcttcactgtctcg
acctttgagggctggccagagttgctgtataggtccattgattcccacatggaggatgtg
ggacccatctataatcacagggttgagatctccatcttctttattatctacatcatcatc
attgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcacatttcaggaacaa
ggagaacaagaatacaagaactgtgagctggacaagaaccagcgccagtgtgtagaatac
gccctgaaggcccggcccctgcggagatacatccctaaaaaccagtatcagtacaaagtt
tggtatgtggtcaactccacctattttgaatacctgatgttcgttttgatccgttcttgg
gtcctggccatgcaacactacggtcagagctgcatgttcaaggaagccatgaacatcctc
aacatgcttttcactggcctcttcactgtcgagatggtcctgaaattaatcgccttcaaa
cctaagggttactttagtgatccttggaatgtttttgacttcctcatcgtaattggcagc
attatagacgtcattctcagtgaaactaatcactatttctgtgatgcatggaatacattt
gacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaacccagct
gaacatacccaatgttcttcctctatgaacgcagaggaaaactctcgcatctcaatcacc
ttcttccgactcttccgcgtgatgcgtcttgtgaagctcctgagccgaggggagggcatc
cggacgctgctttggaccttcatcaagtccttccaggctctcccctatgtggctctttta
atagtgatgctattcttcatctacgctgtgatcgggatgcaggtgtttggtaaaattgca
ctgaacgataccacagaaatcaaccgcaacaacaacttccagaccttcccccaagcagtg
ctgctgcttttcaggtgtgccactggcgaggcctggcaggaaatcatgctggcatgtctc
ccagacaagaagtgcgacccggagtcggagccagccaactccaccgaagccgaccactcc
tgcggcagcagcttcgccgtcttctacttcatcagcttctacatgctctgtgccttcctg
atcatcaatctttttgtagctgttataatggataactttgattacctgacacgggactgg
tccattttaggaccacaccacctggatgagtttaaaaggatctgggcagagtatgaccct
gaagccaaggggcggatcaagcacttggatgtggtgacactgctccggcgcattcagccc
cccctgggctttgggaagctctgcccccaccgagtggcttgcaaacgccttgtctccatg
aatatgccactgaacagtgatggaacagtgatgttcaatgccactctctttgcgttggtc
agaacagcactgaggatcaagacagaaggtaacctggagcaagccaatgaagagcttaga
gcaataattaagaagatctggaagcgcaccagcatgaagctgctggaccaggtggtgccc
cccgcaggtgatgatgaggtgactgtcgggaagttctacgctactttcctgattcaagaa
tatttccggaaattcaagaaacgcaaagaacagggcctggtgggcaagccgtcccagcgc
aatgccctctccttacaggctggtttgcgcacacttcacgacatcgggccagagatccga
cgggcgatctcgggagacctgacagctgaagaagagctagataaggccatgaaagaagct
gtttctgctgcctctgaagatgatattttccggagagctggaggcctgtttggaaaccat
gtcagctactaccaaagtgatggcaggagtgcattcccccagacattcaccacccagcga
cctctgcacatcaacaagtccggcaacaaccagggagacactgagtctccatctcacgag
aagctggtggactccaccttcactcccagcagctactcatcttcaggctccaatgccaac
atcaacaatgccaacaacactgccctgtgccgcttccccagcccacccagctaccccagc
actgtcagcacagtggaaggccacggggccccattgtcacccaccatccgtgtgcaggaa
gctccttggaaactaccttccaaaaagacgcattactacgaaacactgggacgctccagt
tccagagacagccagctggcaattgtttgccaagaggaagtgtctcaggatgagacttat
gatgaaaatttgaatgaagacattgagtactgtagtgaaccaagtctgctctctactgaa
atgctttcataccaagacgatgaaaacagacaacttactccaccagaaaacaacaaagga
gaggacacccggcactctccaaagaaagggtttctgcgctcctcagcactaggtcgaaga
gcatcttttcacttagagtgtctgaaaagacagaaaaaccagggcgtagacgtctcgcag
aagacagttctgcctttacatctggtacatcatcaggcgctagcggtggccggcctgagc
cccctcctgcagcgaagccattcccccaccatgttctcccggctgtgcgcaacgccgccc
gccacgccctgcagccgcggctggccgcagcaggccatccccacactgcgtctcgagggg
gcagagtccagcgagaagctcaacagcagcttcccatcagtgcactgcagctccggcttc
cccgatggcaccggctgcagcagcccgaggagagccaggccggtctccctcaccgtcccc
agccagagcgcagggagcagcaggcagtttcacggcagcgccagcagcctggtggaagcg
gtcttgatttcggaaggactgatgcagtttgctcaagatccaaaattcattgaggtcaca
acccaggagctcgcagacgcctgcgacatgacgatagaagagatggaaaatgcagcagac
aacattctcaatggtaacagcaagcagagccccaatggcaacctcttgccttttgttaac
tgcagggacgcagggcaggacagtgcaggcgaggaagaggaagaggtgcagagcccggat
tgtagaaaaagtcaggaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system