KEGG   Anser cygnoides domesticus (swan goose): 106031051
Entry
106031051         CDS       T04896                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04012  ErbB signaling pathway
acyg04068  FoxO signaling pathway
acyg04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106031051 (CDKN1B)
   04068 FoxO signaling pathway
    106031051 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106031051 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106031051
NCBI-ProteinID: XP_013028636
LinkDB
Position
Unknown
AA seq 183 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRKEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPEFYFRPPRLLKAVCKSAGHQSLDVNGNCQTVIFVG
SQGISEHTHCVDQKTALSEKQTDFAEQCTGQRKRPATDSNVPFGALFLACPAGVSGTRGP
TAG
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgcatttctaatgggagccctaccctggagcgcatggaagcccggcag
tcggagtacccgaagccttcagcctgcaggaacctcttcgggccggtgaaccacgaagag
ttaaacagggacttgaagaagcaccgcaaggagatggaggaggcatgccagaggaagtgg
aatttcgatttccagaatcacaagccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgaattctacttcagacccccgaggctactcaaagctgtctgcaag
tccgccggccaccagagcctggatgtaaacgggaattgccaaaccgtgatttttgtcggt
tctcagggaatctcagagcacactcactgtgtagatcaaaagactgctctttctgaaaag
cagacggactttgcagagcagtgcactgggcagaggaaaagacctgccacagacagtaac
gtaccctttggggcgcttttccttgcgtgccctgccggtgtcagcggcacgcgtggcccc
accgcgggg

DBGET integrated database retrieval system