KEGG   Anser cygnoides domesticus (swan goose): 106031068
Entry
106031068         CDS       T04896                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04012  ErbB signaling pathway
acyg04068  FoxO signaling pathway
acyg04110  Cell cycle
acyg04115  p53 signaling pathway
acyg04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106031068
   04068 FoxO signaling pathway
    106031068
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106031068
   04115 p53 signaling pathway
    106031068
   04218 Cellular senescence
    106031068
SSDB
Motif
Pfam: CDI SICA_C
Other DBs
NCBI-GeneID: 106031068
NCBI-ProteinID: XP_013028641
LinkDB
Position
Unknown
AA seq 152 aa
MERRPGKTAYARRNLFGPVDHKQLQQDFQHMLHNSVKGAQQKWNFDFLQYRLAEGLLQWE
ELEGHKVPAFYSCMVGEAQRPLEHLYWPLDREDNSHHFAQIALTEKPKTSMKTGAKRIPE
GKKRRQTSLTYYYSAKKQIKTNTQAAAKKPTF
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagcggaggccagggaagacagcatatgctcggaggaacctctttggccccgtagac
cacaagcagctgcagcaggacttccagcacatgctccacaacagtgtcaagggggcccag
cagaagtggaacttcgatttcctgcagtacaggctagcggaggggctcctgcagtgggaa
gagctggaaggccacaaggtgcctgctttctacagctgcatggtgggagaggctcagaga
ccactggagcacttgtactggccgctggacagggaagacaacagtcaccactttgcacag
atagcactgacagagaaacccaaaacttccatgaaaacaggagccaagaggatcccagaa
ggaaagaaaagaagacagacatctttaacatattactactcagcaaagaagcaaatcaag
acgaatacacaagctgctgcaaagaagccaactttttga

DBGET integrated database retrieval system