KEGG   Anser cygnoides domesticus (swan goose): 106031856Help
Entry
106031856         CDS       T04896                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00480  Glutathione metabolism
acyg00980  Metabolism of xenobiotics by cytochrome P450
acyg00982  Drug metabolism - cytochrome P450
acyg00983  Drug metabolism - other enzymes
acyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106031856
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106031856
   00982 Drug metabolism - cytochrome P450
    106031856
   00983 Drug metabolism - other enzymes
    106031856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acyg02000]
    106031856
Enzymes [BR:acyg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106031856
Transporters [BR:acyg02000]
 Other transporters
  Pores ion channels [TC:1]
   106031856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5 GST_N_4 Glutaredoxin2_C
Motif
Other DBs
NCBI-GeneID: 106031856
NCBI-ProteinID: XP_013029976
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MAGEHSRSLGKGSTAPGAVPEGLIRLYSMRFCPFAQRTRLVLRAKGISYEVININLKNKP
DWLFEKNPYGLVPILETRKGQLIYESPITCDYLDEAFPGKKLLPSDPYERAFQKMLLERF
SKITPLFFKYAAAVKDGQDTTAQKAEVTEKLGKLEEILSKRNTTFYGGDSVSMIDYMIWP
WFERLEAFELTDSLSHAPKLQRWMEAMKEDPAVQATMTDTQTFKGFLQLYVKNSPEACDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgagcactctcggagcctgggcaagggtagcacggcccccggagcggtgccc
gaggggctgatccggctgtacagcatgcgcttctgccccttcgcccagcggactcgcctc
gtcctcagagccaagggcatcagctatgaagtaattaacatcaatctgaagaacaaacct
gactggctctttgagaagaacccctatgggctggttcctattctggagacccgcaagggc
cagcttatctatgagtccccgatcacttgcgactatttggatgaagcgtttccagggaag
aagctgttgccttcggacccatatgagcgagcctttcagaagatgctcctggaacgcttc
tcaaagataacacctctatttttcaagtatgctgcggctgtcaaggatggacaggatacc
acagctcagaaagcagaggttactgaaaagttaggcaaacttgaagagattctgtccaaa
cgcaacactacgttttatggtggggactcggtctccatgattgactacatgatctggccc
tggtttgaacgcctggaagcatttgagctgactgactccttgagccatgctccaaagctc
cagcgctggatggaggccatgaaggaggaccctgctgtccaggctacgatgactgacacg
cagacattcaaaggcttcctccagctctatgtgaagaacagcccggaggcgtgtgattat
gggctctga

DBGET integrated database retrieval system