KEGG   Anser cygnoides domesticus (swan goose): 106032093Help
Entry
106032093         CDS       T04896                                 

Gene name
OGDHL
Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial isoform X1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00020  Citrate cycle (TCA cycle)
acyg00310  Lysine degradation
acyg00380  Tryptophan metabolism
acyg01100  Metabolic pathways
acyg01200  Carbon metabolism
Module
acyg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acyg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106032093 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    106032093 (OGDHL)
   00380 Tryptophan metabolism
    106032093 (OGDHL)
Enzymes [BR:acyg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     106032093 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 106032093
NCBI-ProteinID: XP_013030359
LinkDB All DBs
Position
Unknown
AA seq 1014 aa AA seqDB search
MSHLKLFAATVKWHGIKLLQKQDIARRVFLHDRRYVSSGTSEPFLSGSNSNYVEEMYYAW
LENPKSVHKSWDLFFRNTNAGQAYDPHLPDQLERKASFLQSHGLAQTPSKAEKLVEDHLA
VQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLGFYGLHESDLDKVFQLP
TTTFIGGNENSLSLREIIKRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMKFTNE
EKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIEYVIMGM
PHRGRLNVLANVIRKELEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRATNKKITLS
LMANPSHLEAVDPVVQGKTKAEQFYRGDTAGKKVMSILLHGDAAFAGQGVVYETFHLSDL
PSYTTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSV
AAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIADGT
VTLQEFEEEIAKYDRICEEAYTRSKDNKILHIKHWLDSPWPGFFNVDGEPKSMSCPPTGI
SEDLLTHIGNVASSVPVKDFKIHSGLSRILRARLEMTKNRVVDWALAEYMAFGSFLKEGI
HVRLSGQDVERGTFSHRHHVLHDQEVDKRTCVPMNHLWEQQAPYTVCNSSLSEYGVLGFE
LGFAMASPNALVCWEAQFGDFHNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPE
HSSARPERFLQMSNDDSDAYPEFSEQFEVSQLYECNWIVVNCSTPANYFHVLRRQILLPF
RKPLIVLTPKSLLRHPEAKSSFDEMVSGTTFQRVIPENGLAAHAPHEVKRVIFCTGKVYY
DLVKERKNQDLEKQVAITRLEQISPFPFDLLKEELEKYPGADLVWCQEEHKNSGYYDYVK
PRFRTIVNHTRPIWYVGREPAAAAATGNKNTHLVSLRRFLDTAFNLEAFEGKTF
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatctgaagttgtttgcggctacggtgaagtggcatggcattaaacttctgcaa
aagcaagatatagccagaagggtgtttttacatgaccgacggtatgtttcatcaggaacc
tcagaaccattcctgagtgggagtaattcgaattatgtggaggaaatgtattatgcgtgg
ctggaaaacccaaaaagtgtacataagtcctgggatttgtttttccgcaatactaatgct
ggccaagcatatgatccccatctaccagatcagttggaaagaaaggcgtcatttcttcag
agccatggcctggcccagacaccaagtaaagctgaaaaacttgttgaagatcatcttgct
gtgcagtctttgataagagcataccaaatccgtggccatcatgttgctcagctagatcct
cttgggattctggatgcagacttggattcatttgttccatctgacttaatcactacgatc
gataaacttgggttttatggcttacatgaatcggatttggacaaagtctttcagctgcct
acaaccactttcataggaggaaatgagaacagtctttctttacgagagatcatcaaacgg
ctggagaatacctactgccaacacataggcttggagtttatgttcatcaatgatgtggag
cagtgccagtggatccggcagaagtttgagacaccaggtgttatgaagtttactaatgag
gagaaaaggactttgttggcaaggctggtgcgctcaatgagatttgaagatttccttgct
cgcaagtggtcttccgagaagagatttggtttggaaggatgtgaagtaatgattcctgca
cttaagaccatcattgataaatccagtgaaatgggaattgaatatgttataatggggatg
cctcatagaggtaggctgaatgtattggctaatgtcatccgaaaagagctggagcagatc
ttctgtcagtttgatcccaaacttgaggcagctgatgagggatctggggatgtaaaatat
catctgggaatgtaccatgagaggatcaacagagcaacaaacaagaaaatcactctgtcc
ctgatggctaacccttcgcacttggaagcagttgatcctgttgtgcaggggaagacaaaa
gctgaacagttttatcgaggggatacagcagggaaaaaggttatgtccattttgttacat
ggggatgctgcctttgcaggacaaggtgtggtgtatgagacatttcatcttagtgacctt
ccatcctataccacaaatggtactattcatgttgtcgtcaacaaccagattggcttcact
acagaccctcgtatggcacgttcctctccatatcctactgatgttgctcgtgtagtcaat
gctcccatttttcatgtgaatgctgatgaccctgaagcagtgatgtacgtgtgcagtgta
gctgcagagtggcgaaacacattcaataaagatgtggttgttgacttagtttgttaccgt
aggagagggcacaatgaaatggatgaaccaatgttcacccagcctctgatgtacaagcag
attcataaacaagtgccagtgctgaagaagtatgctgacaaactgattgcagatgggact
gtaacactgcaagagtttgaggaagaaattgcaaagtacgatagaatatgtgaagaagca
tatactagatctaaggataataagattctacacattaagcactggcttgattcaccttgg
cctggattctttaatgtggatggagaacccaagagcatgtcttgtcctccaactggcatt
tcagaagacctgctgactcacattggcaatgtagctagctcagtgccagtcaaagacttc
aaaatacattcaggactttctcggattttgagagctcgcttggaaatgaccaagaacagg
gttgttgactgggccttagcagaatacatggcttttggctcttttctgaaagaagggatt
catgtccgactaagtggacaggatgtggagaggggtacttttagccatcgccatcatgtg
cttcatgatcaagaagttgacaagagaacgtgtgttcccatgaaccacctctgggagcag
caggccccctatactgtgtgcaacagctccctttctgaatacggtgtcttaggttttgaa
cttggctttgctatggcaagtccaaatgccctggtgtgctgggaggcgcagttcggtgac
ttccacaacacggcgcagtgtatcatagaccagttcatcagctcgggccaggctaagtgg
gttcgtcacaatgggattgttctgctcttgccacatggcatggaaggaatgggtccagag
cattcatcagccaggcctgagaggtttctgcagatgagcaatgacgattctgatgcttat
ccggagttcagtgagcagtttgaagtttcccagctgtatgaatgcaactggattgtggtg
aattgttcaactccagccaattactttcatgtcctcagaagacagatcttgctgcctttc
agaaaaccgctcatcgttttgacacccaagtcgctgctgaggcatccagaagctaaatcc
agttttgatgaaatggtgtctggtaccacttttcaacgtgtgattcctgagaatggattg
gcagctcatgcaccacatgaggtcaagcgagtgattttctgcacaggaaaagtgtactat
gatcttgtgaaagagagaaagaatcaagacttggagaaacaagtagctataaccagactt
gagcagatctcaccattcccatttgacttgctcaaagaagagcttgaaaagtatccaggt
gctgacctagtttggtgtcaggaggaacacaaaaacagtggatattatgattatgtcaaa
cctcgtttccgcactattgtgaaccacacacgacccatatggtatgttggccgagagcct
gctgctgcagctgccacaggcaacaagaacacgcatctggtgtcgctcagaaggtttttg
gatacagctttcaacctggaggcctttgagggaaagacattctaa

DBGET integrated database retrieval system