KEGG   Anser cygnoides domesticus (swan goose): 106032152Help
Entry
106032152         CDS       T04896                                 

Gene name
SI
Definition
(RefSeq) LOW QUALITY PROTEIN: sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00052  Galactose metabolism
acyg00500  Starch and sucrose metabolism
acyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106032152 (SI)
   00500 Starch and sucrose metabolism
    106032152 (SI)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     106032152 (SI)
    3.2.1.20  alpha-glucosidase
     106032152 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 Tmemb_40
Motif
Other DBs
NCBI-GeneID: 106032152
NCBI-ProteinID: XP_013030447
LinkDB All DBs
Position
Unknown
AA seq 1752 aa AA seqDB search
MQKMGKRKFSGLETTLIALFCLVTVVAIVLIALLASGQPGVKTTGFTPVCPNILTAERID
CIPDQVATKSVCTLRGCCWSPQSDTSVPWCFFSSKHGYEVDGSVRSTQTGFEATLRRLPS
PSLFGNDINTVLLTGEYQTSNRFRFKITDPKTKRFEVPHEHVGSFSRSAASNLNYKVEVK
HNPFGIVVTRVNNGRVLFDTTIGPLQYADQFLQLSIKLPSSNIYGVGEHVHKQYRHDVNW
KTWPRDIGPSGSMHNLYGVQTFFLCLEDSSGASFGVFLMNSNAMEFAVQPAPAVTYRTIG
GILDFYILLGNTPEQVVQEYLKLVGLPLLPSYWSLGFQLSRWNYGSLDEVKNVVERNRLI
DLPYDAQITDIDYMEEKKDFTYDKVQFKDLPNFASYLHNYGKKYIIILDPAISTKTLSDG
SEYGSYTRGQSKRVWVNESDGITPLIGEVWPGETVFPDYTNPDCTSWWVEECRLFYNTVP
YDGIWIDMNEISNFVQGSNKGCAQNDLNYPPFTPSILDKLMFSKTLCMDAVQKWGKHYDV
HSLYGYSMAISTNEVINTVFPGKRSFLISRSTFVGSGKHTGHWLGDNAATWEHIKWAIPG
MLEFNLFGIPYIGADICGFFDDTTEELCRRWMQVGAFYPFSRNHNAEGYISLLERIPRFY
SDEATWGVDRQFLWGPGLLISAVLDPGVDVIQAYIPDAVWYEYETGAKIPIRKQWTDLYL
PADKLGLHLRGGYIYPTQQPAPTTSESRKNPMGLIIALDDDGKAYGDLFWDDGDSTGTLD
SKSYIYYEFNVSANILQMNVINNGYVDPNNLKFEEIKILGVLQEITELTVSQNNVPQTSL
HNITYYPSDKVVHITGLQLELGKSYTLQWNQELSINERFDCYPNQDPTKEKCEQLGCVWE
QSPSNPDSPSCYYNSDNPYSVGGVEYSSSGLVANLTVNSINARANENYTAPIGTLRLEVK
YHSNHMLQFKIYDYQNPRYEVPIPLNLPSSPVNTAQDLLYEVSVQRKPFGIQVRRKSTGT
VIWDSQLPTFTFSDMFIQISTRLASQYIYGFGETEHTMFRRNMSWNTWGMFTRDQAPTVS
RNEPSNILQMNVINNGYVDPNNLKFEEIKILGVLQEITELTVSQNNVPQTSLHNITYYPS
DKVVHITGLQLELGKSYTLQWNQELSINERFDCYPNQDPTKEKCEQLGCVWEDVQYVDID
HMERQLDFTLGARFAGLPALINKIKAEGMRFIIILDPTISGNETDYPTFSRGVADDVFIK
WPNTNDIIYSKVWPFLPNVEVNESLPEQTQIQLYGAHAAFPDFFRNSTVEWWKREILEFY
NNPRDSSKSVKFDGLWIDMNEPATFYNGAIGGCRDDLLNKPPYIPHLGSRADGLIVKTPC
MEGQQYLPDGTPVRHYDVHSLYGWSQTKPTLDALRNATKERGIVITRSTYPSSGRWAGHW
LGDNKAAWDQLAKSVIGMMEFSLFGISYTGADICGFFNDSQYELCLRWMQLGAFYPYSRN
HNEKGTRRQDPVSWNATFEDISRKVLNIRYTLLPYFYTLMYDAHAHGSTVIRPVLHEFVE
DRATWDIYEQFLWGPALLISPVMQPNAVTVDAYIPDARWYDYYTDEIHWYXAQSVTLPAP
LDHINLHIRGGYILAWQQPANTTFYSRKNPMGLTVALNDTQMAEGQLYWDDGVRIGTYHL
VLPQLQSLYGRNMSPDRFMRTLCAPARRLTRYCSDIFSPFGKSSACWQPKQLLLEDGSTL
SWSGEKPHVKGP
NT seq 5259 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagatgggcaagaggaagttcagtggtttggaaaccactctgattgccctcttc
tgtctggtgacggtggtggccattgtcctcattgcgctgttagcatcaggacaacctgga
gtcaaaacgacaggatttacgccagtatgtccgaacatattaacagcagagagaattgac
tgcatcccagatcaagtagcaacaaagagcgtctgcaccttgcgtggctgctgctggagt
ccccagagtgataccagtgtgccctggtgttttttctctagtaaacatgggtacgaagtg
gatgggtccgtaagatcaactcagacaggatttgaggccacattaagaaggctgccgtca
ccttccctctttggaaatgatatcaacactgtcctcctcacaggagagtatcagacttcg
aatcgcttccggttcaagattactgatcctaaaacaaaaagatttgaagtcccccatgag
catgtgggatctttcagtagatccgcggcctccaatttaaactacaaagtggaagtgaag
cataatccctttggtattgtggtgaccagagtgaacaatggaagagttctgtttgatact
accataggaccactgcagtatgctgaccagtttttgcagctatcaatcaagcttcctagc
agcaacatttatggggtgggagagcatgtgcataaacagtaccgacacgatgtcaactgg
aaaacctggccaagagatattggcccctctggctcaatgcataacttatatggagttcaa
actttcttcctgtgtttggaagacagctctggagcctcttttggtgttttcctgatgaac
agcaatgccatggagtttgcggtgcagcctgctccagcagtgacctatagaaccattggt
ggtatccttgatttctatatcctcttggggaacactccagagcaagtagtccaggagtac
ctgaagcttgtgggactgccattgttgccctcctactggagcctgggcttccagctcagc
cgctggaattacgggtccttggatgaagtgaagaatgtggtggagaggaaccgtctgatt
gacctcccttatgatgctcagatcactgatattgactacatggaggaaaagaaagatttt
acatatgacaaagtgcagtttaaagatctccctaattttgcatcttatctgcataactat
ggaaaaaaatatattatcatattggatcctgctattagcacaaaaaccctatctgatggt
agtgaatatggaagctacaccaggggacagtctaaacgagtctgggttaacgaatcagat
ggaataacaccattaattggagaggtgtggccgggggaaactgtgttcccagactacacc
aacccagactgcaccagctggtgggtggaagaatgcagattgttttataacacagtgccg
tacgatggaatctggattgacatgaatgaaatatccaactttgttcaaggctcaaataag
ggttgtgcacaaaatgacttaaactatcctccatttactcccagtattcttgataaactc
atgttttccaagacactttgtatggatgcagtgcagaagtggggcaaacactatgatgtc
cacagtctttacggatattccatggccatatcaacaaacgaggtcatcaatacagtgttt
cctggaaaacgaagcttcctgatttcgaggtctacttttgtgggatcaggaaagcacacg
ggacactggctgggagataatgcagcaacatgggaacacataaaatgggcgatacctgga
atgctggaatttaacctctttggaattccttatattggagccgatatttgtggtttcttt
gatgacacgacagaagaactttgcaggcggtggatgcaagtaggagccttttacccattt
tcccggaatcacaatgctgaaggatacatatcacttttagaaagaattcccaggttctac
tcagatgaagcgacgtggggagttgataggcagttcctgtggggtcctggtctacttatt
tctgctgtccttgacccgggtgtggatgtaattcaagcatatattcctgatgcagtgtgg
tatgagtatgaaacgggggcaaaaatacccataagaaaacaatggactgatttgtacctg
ccagcagacaaactggggctccatttgagaggaggctacatttaccctacccaacaacca
gctcccacaacatctgaaagtcgcaagaatccaatgggacttataattgccctggatgac
gacggtaaagcttacggggacttgttctgggatgatggagactctacaggtacacttgac
agtaaaagctacatttactatgagtttaatgtttctgctaatattctacaaatgaatgtc
ataaacaatggttatgtcgatccaaacaacctgaagtttgaagaaatcaaaatactggga
gtgctccaggaaataacagaacttactgtctctcagaacaatgttccacaaacttcttta
cataatatcacctactatccttcagataaggttgttcatataacaggacttcagcttgaa
ctgggaaaatcctacacactgcaatggaatcaagaattaagtatcaacgaaaggtttgat
tgttatcccaatcaggatccaacaaaagaaaaatgtgaacaacttggctgtgtctgggag
cagtcaccatcaaacccagacagtccatcctgctactacaactccgacaacccttactct
gttggtggagtagaatactcctcatcaggtttggtagccaacctgaccgtaaacagcatc
aatgccagagctaatgagaattacactgcaccaattggtacgctgcgcttggaggttaaa
tatcacagcaaccacatgctgcaatttaagatttatgattaccagaatccacgatatgag
gttcctataccattaaatctcccaagctccccagtgaatacagcccaggacctactctat
gaagtatcagttcagagaaaaccatttggtatacaggttcgacgcaaaagcacagggaca
gtcatctgggattcacagctgcctaccttcacattcagcgacatgttcattcagatttct
acccgtttggcatcccaatatatatatggatttggagaaacagagcacaccatgtttcga
cgcaacatgagctggaacacctggggaatgttcacaagggaccaggctcctactgtaagt
agaaatgaacctagcaatattctacaaatgaatgtcataaacaatggttatgtcgatcca
aacaacctgaagtttgaagaaatcaaaatactgggagtgctccaggaaataacagaactt
actgtctctcagaacaatgttccacaaacttctttacataatatcacctactatccttca
gataaggttgttcatataacaggacttcagcttgaactgggaaaatcctacacactgcaa
tggaatcaagaattaagtatcaacgaaaggtttgattgttatcccaatcaggatccaaca
aaagaaaaatgtgaacaacttggctgtgtctgggaggatgtccaatacgtagatattgac
catatggaacggcaactggacttcactcttggcgcacgctttgcgggattaccggctcta
attaacaaaataaaagcagaaggaatgagattcatcattatcctggatccaactatctct
ggaaacgaaactgattatcctactttctcgagaggtgtagccgacgatgtcttcatcaag
tggccgaataccaatgacattatatattccaaggtctggccgtttcttcccaatgttgaa
gtcaatgagtcacttcccgagcaaacccaaatacagctctacggagcacatgcagctttc
ccagacttcttccgcaattccacagtggagtggtggaagagagaaatcctggagttctac
aacaatccccgtgacagctcaaaaagtgtgaagtttgatggcctgtggattgacatgaat
gaaccggcaactttttataatggcgccattggtggttgtagagatgacctccttaataag
ccaccatatattcctcatttgggatcccgggcagatggtttaattgtcaaaactccatgc
atggaaggtcagcagtatcttccggacggtaccccagttagacactatgatgtccacagt
ctttacggatggtcacaaacaaaacctaccctcgacgctttgcggaatgccacaaaagag
cgtgggatcgtcatcacccgctcaacgtatcccagcagtggaagatgggctggacattgg
ctgggtgataacaaggcagcttgggatcagctggctaaatctgttattggtatgatggag
ttcagcctctttggaatatcttatacaggagctgatatctgtggcttctttaatgactca
cagtatgagttgtgtcttcgctggatgcagctgggtgcattttacccatattcaaggaat
cacaatgagaaaggaacaagaaggcaagatcctgtttcctggaatgcaacatttgaggac
atttccaggaaggtgctgaatataagatacactctgttaccctatttttatacattaatg
tacgacgcccatgcccacggcagtactgtgatccgccccgtactccatgagtttgtggaa
gacagagcaacatgggatatatatgaacaattcctttggggacctgcactgctcatcagc
cctgtaatgcaaccgaatgctgtaacggtggatgcttacatacctgatgcccgctggtat
gattactacacagatgaaatacattggtattaggcacagtcagtaactctaccagctcct
ttggaccatatcaatcttcatatccgaggcggttacattctcgcatggcaacaacctgct
aatacaactttttacagccggaaaaacccaatgggacttactgttgctttgaatgacact
cagatggcagaaggacagctttattgggatgatggggttcgcattggtacgtatcatctt
gttttgccacagctacagagcttatatggacgaaacatgtcaccagaccgcttcatgagg
accctctgtgctcctgctcgccgcctgactcgctactgcagcgacatcttcagcccattt
ggcaaatcgagtgcatgctggcagccaaaacaactgctcctggaggacggctcaacgttg
agttggagtggagaaaaaccacacgtgaagggcccttga

DBGET integrated database retrieval system