KEGG   Anser cygnoides domesticus (swan goose): 106032819
Entry
106032819         CDS       T04896                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04010  MAPK signaling pathway
acyg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106032819 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106032819 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:acyg04052]
    106032819 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:acyg00536]
    106032819 (FGF1)
Cytokines and growth factors [BR:acyg04052]
 Growth factors
  Growth factors (RTK binding)
   106032819 (FGF1)
Glycosaminoglycan binding proteins [BR:acyg00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106032819 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 106032819
NCBI-ProteinID: XP_013031414
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTKSGQYLAMDTNGLLYGSQLLGEECLFLERIEENHYNTYVSKKHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPGSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggagataaccacgttcaccgccctgaccgagaagttcaacctgcccctg
gggaactacaagaagcccaagctcctgtactgcagcaacgggggccacttcctacggatc
cttcccgacggcaaggtggatgggacgcgggaccgaagcgaccagcacattcagctccag
ctaagcgcggaaagcgtgggtgaggtttatataaagagcaccaagtctgggcagtacctg
gcaatggacaccaacgggctcttgtacggctcgcagctactgggcgaagagtgcctgttc
ctcgagcggatcgaggagaaccattacaacacgtacgtctccaagaagcacgccgataag
aactggttcgtcggtctgaagaagaacgggaacagcaagctggggccacggactcactac
gggcagaaggcgatcctcttcctcccgctgcccgggtcagccgactga

DBGET integrated database retrieval system