KEGG   Anser cygnoides domesticus (swan goose): 106033539Help
Entry
106033539         CDS       T04896                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00052  Galactose metabolism
acyg00500  Starch and sucrose metabolism
acyg01100  Metabolic pathways
acyg04142  Lysosome
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106033539
   00500 Starch and sucrose metabolism
    106033539
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106033539
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acyg04147]
    106033539
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106033539
Exosome [BR:acyg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106033539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Ribosomal_L28
Motif
Other DBs
NCBI-GeneID: 106033539
NCBI-ProteinID: XP_013032588
LinkDB All DBs
Position
Unknown
AA seq 934 aa AA seqDB search
MKLYQKLRTAVPRLVVSQEEDEEEEEEDVDAPTPTGHSRLAPWWVGSGLLLTAVLLSTVT
VWVLRQVSGGWHGPAPPSQCHQVPESHRFDCYPERRVVVTQELCEGRGCCFVETPPAAGG
ERGVPWCFYPPDFPSYALQSLNQTALGMVGLLVRREKAYYPRDIEVLRLDVELETDTRLH
VKITDAANPRYEVPLEVPRAEKRAENPIYSLDFSKDPFGLLLRRRDTGTVLLNTTVAPLI
FADQFLQISTALPSRFLYGLGEHRSTLLHSLDWSTLTLWARDVSPTESFNLYGAHPFYLL
LEEGGDAHGVFLLNSNAMEVALQPAPALTWRTIGGVLDFYIFLGPDPNTVIQQYQEVIGF
PAMPPLWALGFHLCRWGYGSSNETWQTVRAMRNFQIPQDAQWNDIDYMDGYRDFTFDPQK
FASLPSLVEDLHKHGQHYVMILDPGISSTSPRGSYWPFDEGLRRGLFINTTQGQPLIGQV
WPGYTAFADFSNGDTRRWWLENLQRFHAHVPFDGVWIDMNEPSNFMDGSEEGCPPGELDS
PPYTPAVLGDSLSAKTVCASAKQSASVHYNLHNLYGLMEAEATASALIQIRGKRPFVISR
STFPSQGRYSGHWLGDNRSQWKDMYYSIPGMLSFSLFGIPLVGADICGFSGSTSEELCTR
WMQLGAFYPFSRNHNSQNEKAQDPTAFSPAARTAMKDVLLTRYSLLPFLYTLFHRAHLHG
ETVARPLFFEFPRDTATYGLDRQFLWGRSLLVTPVLEPGVDSVTGYFPRGVWYDFYTGSS
VNSSGEMLKLPTPLEHLNLHLREGSILPTQKPGPTSEASRGNPLRLIVALSPGATAWGDL
FWDDGESLDTFERGSYSYLVFNATENVLTSSVLHTSTKAASATIGTLSIYGVREPPHKVL
LNGQEKPFSYLDNQVLTVSGLGLGLDQAFSLQWL
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtaccagaagctgaggacagcagtgccgcggctggtggtgagccaggaggag
gatgaggaggaggaggaggaggatgtggacgccccgacacccaccggccacagcaggctg
gccccgtggtgggtgggcagcgggctgctgctgaccgccgtgctgctgagcaccgtcacc
gtctgggtgctgcgacaagtgtcagggggctggcacggccccgcgccgccctcccagtgc
caccaggtccccgagagccaccgcttcgactgctacccggagcggcgcgtggtggtgacc
caggagctctgcgagggccgggggtgctgcttcgtcgagacccccccggcagcggggggc
gagaggggggtgccctggtgcttctacccccccgacttccccagctacgcgctgcagagc
ctcaaccagacggcgctgggcatggtggggctgctggtgcgcagggagaaggcctactac
ccccgggacatcgaggtgctgcgcctggatgtggagttggagacggacacacggctgcac
gtcaagataaccgatgcagccaaccctcgctacgaggttcctctggaggttccccgggca
gagaagagagcagaaaaccccatctacagcctggacttctccaaggacccctttgggctg
ctgctgcggcgccgagacacggggacggtgctgctcaacaccaccgtggcccccttgatc
ttcgctgaccagttcctgcagatctccacggcgctgccctccaggttcctgtacgggctg
ggggagcaccgcagcaccctgctgcacagcctggactggagcaccctcaccctctgggcc
cgcgacgtctcccccacggagtcgttcaacctgtacggcgctcaccccttctacctgctg
ctggaggagggcggcgatgctcacggggttttcctcctcaacagcaacgccatggaggtg
gccctgcagcccgctccggccctgacctggaggaccatcgggggggtgctggatttttac
atcttcctggggcctgaccccaacacggtcatccagcagtaccaggaggtgataggtttc
ccggccatgccgcccctctgggcgctcggcttccacctctgccgctggggctatggctcc
agcaacgagacctggcagaccgtgagggccatgaggaacttccagatcccacaggacgcg
cagtggaacgacatcgattacatggatgggtaccgggacttcaccttcgatccccagaaa
ttcgcctccctcccctcgctggtggaggatctccacaagcacgggcagcactacgttatg
atcttggaccccggcatcagcagcaccagcccgcggggctcctactggcctttcgatgaa
ggtttgagacggggtttgttcataaacaccacccaagggcagccgctgatcgggcaggtc
tggcccggctacacggccttcgccgacttctccaacggggacacgcgccggtggtggctg
gagaacctgcagcgcttccatgcccacgtgccctttgatggcgtctggatcgacatgaac
gagccgtccaacttcatggatgggtctgaggagggctgcccgccgggagagctcgacagc
cccccgtacacgccggccgtgctgggcgattccctgtctgccaagacggtgtgcgcctcg
gcgaagcagagcgcctcggtgcactacaacctgcacaacctctacgggctgatggaggcc
gaagcgacggcgagtgccttgatccagatccgggggaagcgccccttcgtcatctcccgc
tccaccttccccagccagggccggtactcggggcactggctgggtgacaaccgcagccag
tggaaggacatgtattactccatccccgggatgctgagcttcagcctcttcgggatcccc
ctggtgggggccgacatctgcggcttctccggcagcacctcggaggagctgtgcacccgc
tggatgcagctcggggccttctaccccttctcccgcaaccacaactcccagaatgagaag
gcccaggacccgacggcgttcagccccgcggcaaggacagctatgaaggatgtgctgctg
acccgctactccctcctgcccttcctctacacgcttttccaccgtgcccacctgcacggg
gaaaccgtcgcccggcccttgttctttgagtttccccgggacacggccacgtacgggctg
gacaggcagttcctgtggggccgcagcctgctggtgacgccggtgctggagcccggggtg
gactcagtgacgggctatttcccccgaggcgtgtggtacgacttctacacgggctcctct
gtgaacagcagcggggagatgctgaagctgccgacccccctggagcacctcaacctgcat
ctccgcgagggctccatcctgcccacccagaaacccgggcccaccagcgaggccagccga
gggaaccccctgcgcctcatcgtggccctgtccccgggtgccaccgcctggggggacctc
ttctgggatgacggcgagagcctggacaccttcgagcggggcagctactcctacctggtg
ttcaatgccacggagaacgtcctcacctccagcgtcctccacaccagcaccaaggctgcc
tccgccaccatcggcaccctgagcatctacggggtgcgggagcctccccacaaggtcctc
ctgaacggccaggagaagcccttctcctacctggacaaccaggtcctcaccgtgagcggg
ctgggcctggggctggaccaggccttctccctgcagtggctgtga

DBGET integrated database retrieval system