KEGG   Anser cygnoides domesticus (swan goose): 106034056Help
Entry
106034056         CDS       T04896                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00590  Arachidonic acid metabolism
acyg01100  Metabolic pathways
acyg04370  VEGF signaling pathway
acyg04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106034056 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106034056 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106034056 (PTGS2)
Enzymes [BR:acyg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106034056 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 106034056
NCBI-ProteinID: XP_013033396
LinkDB All DBs
Position
Unknown
AA seq 571 aa AA seqDB search
MTTGFDQYECDCTRTGYYGENCTTPEFFTWLKLTLKPTPNTVHYILTHFKGVWNIINNIP
FLRDTIMRYVLTSRSHLIDSPPTYNSDYNYKNWEAYSNLSYYTRSLPPVGRDCPTPMGVK
GKKELPDSKLIVEKFLLRKKFIPDPQGTNVMFTFFAQHFTHQFFKTDHKKGPGFTKALGH
GVDLNHIYGETLERQLKLRLLKDGKLKYQMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDEQLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFKSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEIG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFEIINTASLQKLICNNVKGCPFTAFHVLNPE
PTEATINVSTSNTAMEDINPTLLLKERSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggatttgaccagtatgaatgtgactgcacaaggacaggatattatggggaa
aattgtacaacaccggaattcttcacatggctgaaactgacattgaaacctacgccaaat
actgtccactacattctcacccacttcaaaggagtctggaacatcatcaacaacatcccc
ttcttacgagatactattatgagatatgtattgacttcaagatcacatttgattgacagc
ccaccaacttacaatagtgactataattacaaaaactgggaagcttattccaatctttcc
tattacacaagaagccttcccccagtaggacgtgactgtccgacaccaatgggtgttaaa
ggtaagaaagagctcccagattcaaagctgattgtggagaagtttttgctgcggaaaaaa
tttattcctgacccacaaggcacaaatgtgatgttcacattctttgcccaacacttcact
catcagttctttaagacagaccacaagaaaggacctggtttcactaaagctcttggccat
ggggttgacttgaatcacatttatggagagactctggagagacagcttaaactgagactt
ctcaaggatggaaagctaaaataccagatgatcgatggggaaatgtatccacccacagtg
aaggacactcaggcagagatgatctaccctcctcatgttcctgaacacttgcagttttct
gtcgggcaggaggtgtttggtttggtcccaggtttaatgatgtatgctacaatatggctg
agagaacacaatcgggtctgtgacatcctgaaacaggagcatccagagtgggatgatgag
cagttattccaaactactagactcatactgataggagagacaatcaagattgttattgaa
gattacgtgcaacacttgagtggctaccacttcaaactcaagttcgatcctgagcttctg
ttcaaccagcgattccaataccagaaccgaattgcagctgaattcaataccctgtaccat
tggcacccacttctgcctgacacttttcaaatacatgaccaggagtacactttccagcag
ttcctctacaacaactctataatgctggaacatggcctttcccatatggtgaaatctttc
tccaagcaaagtgctggcagggttgctggtggaaaaaatgttcctgctgcagtacagaaa
gtagcaaaggcttcaattgaccaaagcagacaaatgagataccagtccttgaatgagtac
aggaaacgcttcatgttgaaaccatttaaatcgtttgaagaacttacaggagaaaaagaa
atggctgctgaactggaagaactttatggagacatagatgctatggagctgtatccaggc
ctccttgtagaaaagccacgaccaggtgccatctttggcgaaacaatggtagaaattggc
gcaccattctctctgaaaggactgatgggaaatgctatctgttccccagagtactggaag
ccgagcacctttggtggaaaagtgggatttgaaataatcaatactgcctccttacagaag
ctcatctgcaacaatgtgaaaggctgtcctttcactgctttccacgtcttaaatcctgaa
cccacggaggcaactattaatgttagtacctcaaacacagcaatggaagatatcaacccc
acactactactgaaagagcgatctgctgagttataa

DBGET integrated database retrieval system