KEGG   Anser cygnoides domesticus (swan goose): 106036842Help
Entry
106036842         CDS       T04896                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3-like isoform X1
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04010  MAPK signaling pathway
acyg04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106036842
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106036842
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acyg01001]
    106036842
Enzymes [BR:acyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     106036842
Protein kinases [BR:acyg01001]
 Serine/threonine kinases: STE group
  STE11 family
   106036842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like
Motif
Other DBs
NCBI-GeneID: 106036842
NCBI-ProteinID: XP_013037904
LinkDB All DBs
Position
Unknown
AA seq 621 aa AA seqDB search
MDEEEALNSIMKDLAALGKCGGLLDNNRNKNSVHSSKQQRNVRIKFEYEGEKRIIQFPRP
VKFKEVVQKVTDAFGQTMDLVCVNNELLIPLKSQEDLDKALEQLELSPSLKSLRILVSAP
KKANLLQPNNSKQHEMRISRSMGDIMGSLYKDSERTRKYSTGSLHTGRSSPPPGSVPEEQ
QQIARQGSYTSINSEGEFIPETMDQNMLEAFISPDGSLSGSCQSLDRSVDSPPFTQTPVP
GRKSHPKDGLDCMEFDIPFCERFGKGGTFPRQYHLSQSRKDYSDGRRTFPRSYFPQENLF
QLVPSSRTKSFNGDSKLSTLQYDEYRPKWWNNCEKGLQVFSTSPTKARNSLQAPVNWRLG
KLLGRGAFGEVYLCYDADTGRELSVKQVPFDPDSQETSKEVNALECEIQLLKTLRHDRIV
QYYGCLRDPEERKLSIFVEYMPGGSIKDQLKAYGALTENVTRKYTRQILQGVFYLHSNMI
VHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVISGEGYG
RKADVWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPDGVSNSCRNFLKQIFV
EEKRRPTAEDLLRHPFVNCGL
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaagaagctctgaattctattatgaaggatttggcagcgttgggcaaatgt
ggggggctgctggacaacaacaggaataaaaacagcgtccactccagcaaacagcagcga
aatgtcaggatcaagtttgaatatgaaggagagaaaaggattatccagtttccaagacca
gtcaaattcaaagaagtggtgcagaaagtcacggatgctttcggacagacgatggactta
gtctgtgtgaacaatgagctcctgatccccctgaaatcccaggaagacttggacaaagcg
ctggaacagttggagctgagcccttccctgaagagcctgcggatccttgtgagcgctcca
aagaaagcgaatctcctccagccgaacaacagcaaacagcacgagatgaggatctccaga
tccatgggggatatcatgggatccctgtacaaggactccgagaggacgcggaagtactca
acaggctctctgcacactggccggagctctccgcccccgggcagcgttcctgaagagcag
cagcagatcgctcgccagggatcctacaccagcatcaacagcgagggcgagttcatcccc
gagaccatggatcagaatatgcttgaagctttcatcagccccgacgggtcgctgtctggg
agctgccagtctctggacaggtctgtggacagccctcccttcacccaaacccctgttcct
ggaaggaagagccatcccaaagacggtcttgactgcatggaatttgacatcccgttctgc
gaaaggtttgggaaagggggcaccttccccaggcagtaccacctctcccagagtcgcaag
gactacagtgacggccggaggactttccccaggagttacttcccacaggaaaacctgttc
cagctggtcccttccagccgaaccaagagctttaatggggacagcaagctcagcaccctg
cagtatgacgagtacaggcccaaatggtggaacaattgtgaaaaaggtctgcaggtcttc
agcacctcccctacaaaagctaggaactccctacaggcaccagtgaactggaggttgggg
aagctgcttggaagaggagcttttggggaagtttacctctgctatgatgctgacactggc
cgagagctgtcggtgaagcaggtgccatttgaccctgacagtcaagagacaagtaaagag
gtgaatgctttggagtgtgagattcagctgctgaagactctccgccacgacaggatagtg
cagtactatgggtgtttgcgggatcccgaggagaggaagctgtctatctttgttgaatac
atgccagggggttcaataaaggaccagctaaaagcgtacggtgctctgacggagaacgtc
actcggaagtacaccaggcagatcttgcagggagtcttctacttgcacagcaatatgatt
gtccacagggacattaaaggtgccaatattttgcgagattctgctggaaatgtgaaactt
ggagattttggggccagcaaacgtatccagaccatctgcatgtctgggaccgggattaaa
tctgtcacgggaacgccgtactggatgagcccagaggttatcagcggagaaggctacgga
aggaaagctgacgtgtggagcgtggcctgcaccgtggtggagatgctaacggagaagccg
ccgtgggcggagttcgaagccatggcggcgatttttaagatcgccacgcagcccaccaac
ccccagctccccgacggcgtctccaactcctgccgcaacttcctcaagcagatcttcgtg
gaggagaagcggaggccgacggccgaggacctgctgaggcaccccttcgtcaactgcggg
ctctga

DBGET integrated database retrieval system