KEGG   Anser cygnoides domesticus (swan goose): 106036954
Entry
106036954         CDS       T04896                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04010  MAPK signaling pathway
acyg04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106036954 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106036954 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:acyg04052]
    106036954 (KITLG)
Cytokines and growth factors [BR:acyg04052]
 Growth factors
  Growth factors (RTK binding)
   106036954 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 106036954
NCBI-ProteinID: XP_013038110
LinkDB
Position
Unknown
AA seq 289 aa
MEEDFVPSNTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYMITLK
YVPKMDSLPNHCWLHLMVPEFSRSLHSLLQKFSDISDMSDVLSNYSIINNLTRIINDLMA
CLAFDKNKDFIKENGHLYEERRFFPEQFFEVFNSTIEVYKEFADTLDKNDCILPSTVETP
ENDSRVAVTKTILFPPVAASSLRNDSIGSNTSSNKEALGFISSSSLQGISIALTSLLSLL
IGFILGAVYWKKTHPKSRPESDETTEYHGCQEENEIRMLQQKEKEHLQV
NT seq 870 nt   +upstreamnt  +downstreamnt
atggaggaagattttgtcccttccaatacttggattatcacttgcttttgtcttcaacta
ctcctacttaatcctcttgtcaaagcccaaagttcctgcgggaatccagtgacagatgat
gtaaatgacattgcaaaattggttggaaatctgccaaatgattatatgataacccttaaa
tatgtcccgaagatggatagcttgcctaatcactgttggttgcatttgatggtgcctgaa
ttttcaaggagtctacatagtcttctccagaaattttctgatatttccgatatgtctgat
gttttaagcaactattcaatcatcaataatctcacaaggataattaatgatcttatggca
tgtctagcttttgataaaaataaggattttataaaagaaaatggtcacctttatgaagaa
cgtcgcttctttccggagcagttttttgaggtctttaatagtaccattgaggtctacaaa
gagtttgcagacacattggataagaatgactgcattctgccttcaacagtagaaacacca
gagaatgattccagagtcgctgtcacaaaaacaattttgtttcctcctgttgctgccagc
tcccttaggaatgacagcattggcagtaacactagcagtaacaaagaggcacttggcttc
attagcagctccagccttcaagggatcagcatagcattgacatcattactgtctcttctt
attggctttattttgggagctgtatattggaagaaaacacatcccaaatccagaccagaa
agtgatgaaactacagagtatcatggctgtcaagaggaaaatgagataaggatgttgcag
caaaaagaaaaagaacatctacaagtgtag

DBGET integrated database retrieval system