KEGG   Anser cygnoides domesticus (swan goose): 106038907Help
Entry
106038907         CDS       T04896                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00010  Glycolysis / Gluconeogenesis
acyg00030  Pentose phosphate pathway
acyg00051  Fructose and mannose metabolism
acyg00052  Galactose metabolism
acyg01100  Metabolic pathways
acyg01200  Carbon metabolism
acyg01230  Biosynthesis of amino acids
acyg03018  RNA degradation
Module
acyg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106038907 (PFKP)
   00030 Pentose phosphate pathway
    106038907 (PFKP)
   00051 Fructose and mannose metabolism
    106038907 (PFKP)
   00052 Galactose metabolism
    106038907 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106038907 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acyg01009]
    106038907 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:acyg03019]
    106038907 (PFKP)
Enzymes [BR:acyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106038907 (PFKP)
Protein phosphatases and associated proteins [BR:acyg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106038907 (PFKP)
Messenger RNA biogenesis [BR:acyg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106038907 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106038907
NCBI-ProteinID: XP_013041203
LinkDB All DBs
Position
Unknown
AA seq 770 aa AA seqDB search
MTLNGFSFPPQSGMNAAVRAVVRMGIYVKAKVYFVYEGYQGMVDGGDNIVEVSWESVSSI
LQVGGTVIGSARCKSFRTREGRLQAAYNLVQRGITNLCVIGGDGSLTGANLFREEWSGLL
EELAQKGKIDEEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTA
QSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWEDSMCVKLSENRARKKR
LNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQRGGTPSAFDRILASRM
GVEAVLALLEGTPDTPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDEGRFVEAVRLRGR
SFENNLNTYKLLSQKKPDAELPKTNFNVAVLNVGAPAAGMNAAVRAAVRVGITEGHKMFA
VIDGFEGFSRGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLEKIADQMRTNNINALMV
IGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDR
IKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQFDIRELQANVEHLTEK
MKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNF
GTKISAKAMQWISKKLKETYRKEEGKVFANTDDSVCLLGMRRRNLVFQPVAELKNETDFV
HRIPMEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMHSPKEAETGAI
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaaatggcttctcttttcctccccagtcaggtatgaatgctgctgtgcgtgca
gtagtacgcatgggaatctatgtaaaagccaaagtctattttgtttatgagggttaccaa
ggaatggttgatggaggtgataatattgttgaagtttcatgggaaagcgtttcaagtatc
ctgcaagtaggaggtacagttattggtagtgcacggtgcaaatcctttcgtactcgggag
ggccgcctgcaggcagcctacaacttggttcagagaggaatcactaatctgtgtgtgatt
ggtggagatggtagtttaaccggtgccaatctgttccgtgaagaatggagtggacttcta
gaagaactagcacagaaaggaaagattgatgaagaggctgttaagaaatatgcttatctt
aacattgtgggaatggttggatccatagacaatgacttctgtggcactgatatgaccata
ggtactgactcagccttgcacagaatcattgaagtcgtggatgccatcatgaccactgct
caaagccatcagagaacatttgttctggaggttatggggagacactgtggatatctagct
cttgtcagtgccttagcttgtggtgcggattgggtatttattcctgaatacccaccagaa
gaaggatgggaggattcaatgtgtgttaagctttcagagaatcgtgcacgaaagaaaagg
ctgaatattattattgtggctgaaggagctattgattgccacaacaaacctataacatca
gagaaggttaaggatcttgtggttcagcgtcttgggtttgacactcgggtgactatcttg
ggtcatgtgcaaagaggtggaaccccttcagcctttgacagaattctggcaagccgtatg
ggtgtagaagctgtgcttgcccttttagaaggcactccagatactcctgcctgtgttgtg
tcgctgtctggaaaccaggctgtccgtctgcctttgatggagtgtgtgcagatgactcaa
gaagtacagaaagccatggatgaaggaagatttgttgaggctgtgaggcttcgtggaagg
agctttgaaaacaaccttaacacctacaaattattgtcacaaaaaaaaccagatgctgag
cttccgaagactaattttaatgtggcagtcttaaatgttggtgctcctgcagctggaatg
aatgctgcagtgagggctgcagtgagagttggcataactgaaggccataaaatgtttgcc
gtcattgatggatttgaaggtttttctagagggaagataaaggaaatcagctggggagat
gttggaggctggactggtcaaggaggatcgattcttggtaccaaacgtactcttcctgct
aagtatttggagaagatcgctgaccagatgcgcactaacaacattaacgctcttatggtt
attggtggatttgaggcatacctcggacttttggaattgtcagctgcccgagagaaatat
gacgaattctgtgttccaatggttatggttcctgcaacagtatccaacaatgtaccgggt
tcagatttcagcattggtgcagatactgctctgaacactataactgatacgtgtgatcgc
atcaaacagtcagccagtggtaccaaacgtcgtgtattcatcattgagaccatgggcggt
tattgtgggtacctggccaatatgggggcccttgcggcaggagctgacgctgcttatatt
tttgaagaacagtttgatattcgagagctccaggctaatgtggaacacttaactgaaaag
atgaaaaccagtatccagcgtggtctagtcctgagaaatgagaactgcaatgagaactac
acaactgacttcatttatcagctgtattccgaagaaggaaaaggagtgtttgactgtcga
aaaaatgtattgggccacatgcagcagggtggtgcaccttcgccatttgatagaaacttc
gggacaaaaatttctgcaaaagctatgcagtggatctccaaaaagctgaaagaaacctac
cggaaagaagaaggaaaagtatttgccaatactgatgactcagtctgtttgctgggaatg
cgtagacgcaaccttgttttccaaccagtggctgagctgaagaatgaaacagactttgta
cataggattccaatggagcaatggtggctgaagctgcgaccactgatgaaaatcctggcc
aaatacaagaccagctatgatgtttcagattcaggccagctggagcatgttgctatgcac
agcccaaaggaagcagaaaccggagccatctaa

DBGET integrated database retrieval system