KEGG   Anser cygnoides domesticus (swan goose): 106039499Help
Entry
106039499         CDS       T04896                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04068  FoxO signaling pathway
acyg04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106039499 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106039499 (SOD2)
Enzymes [BR:acyg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106039499 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 106039499
NCBI-ProteinID: XP_013042204
LinkDB All DBs
Position
Unknown
AA seq 232 aa AA seqDB search
MSVKAPSKTSSFCFFSPRSRANLIAPLGCLVSRQKHTLPDLPYDYGALEPHINAEIMQLH
HSKHHATYVNNLNVAEEKYKEALAKGDVTAQVSLQPALKFNGGGHINHTIFWTNLSPNGG
GEPKGELMEAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKEQGRLQIAACANQDPL
QGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYASCKK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttaaagcaccgagtaagacatcctccttctgttttttctctcctagaagcagg
gccaacctgatagcacctctggggtgcttggtgtctaggcaaaagcacacgcttcctgac
ctgccgtatgactatggcgctctggaacctcacattaacgcagagatcatgcagctgcac
cacagcaagcaccatgccacctacgtgaacaacctgaacgttgcggaggaaaaatacaaa
gaggcactggcaaaaggtgatgttacagctcaggtgtcgcttcagcctgcactgaagttc
aatggtgggggtcatatcaatcacaccatcttctggacaaacctttcacctaatggagga
ggagagcctaaaggagaattgatggaagccatcaagcgcgactttggttccttcgcaaac
ttcaaggagaagctaacagctgtatcagttggtgttcaaggatcaggctgggggtggctt
ggctataacaaagagcaagggcgcctacagatagcagcttgtgcaaatcaagaccctttg
caaggaacaacaggtcttattcctttgctaggaatcgatgtatgggaacatgcctattat
cttcaatataaaaatgttcgacctgattatttgaaagccatctggaacgtcatcaactgg
gagaatgtatcttcaagatatgcatcttgcaaaaagtag

DBGET integrated database retrieval system