KEGG   Anser cygnoides domesticus (swan goose): 106040487Help
Entry
106040487         CDS       T04896                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acyg03036]
    106040487 (HDAC10)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106040487 (HDAC10)
Chromosome and associated proteins [BR:acyg03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106040487 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl STAR_dimer MAP65_ASE1
Motif
Other DBs
NCBI-GeneID: 106040487
NCBI-ProteinID: XP_013043816
LinkDB All DBs
Position
Unknown
AA seq 679 aa AA seqDB search
MASGTALIYDEEMTSHKLLWNDPICDIEVPERLSTSYEQLQFYHLVERCVHVPAREGTEE
EILLVHSSEHLEVAKSTQTMGEEELKRVSGNYDAFFFHPNTYRCARLAVGATLQLVDSVM
LGKVCNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKLKYGLQRILIVDWDVHHGQG
TQYIFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGKGKGFNINLPWNKVGMGNSDY
LAAFFHVLLPMAFEFDPELVLVSSGYDSGIGDPEGQMNATPEVFAHLTHFLMQLANGKLC
VILEGGYHLKSLSESVCMTVKTLLRDPIPQVTGEMAPCLSAIESIQNVRAAHKPYWKWLM
YEDTSFLHNLSTKSHLPKTTNTNPSTDLEDKITNTSEAVKIERFLELHMRNILFPVPPVR
TATTESKASSYLLPAPVCVVKEMDKNEVKSLASDFYADLVKEDKTLHSLGSMLAILDKIL
KKEVCNGIADSPTASVSVDVALRYSVHFGFQRVLCIFVGDMQIIPNTEDGKVLVINVCEK
EQSGKIGSKYFISLNWKEDADRSDFFSAVLGFILPVAYSYQPNLIVIAVGPNRSIGISGI
SLLFGLLQGLAESRILAVIEDTDVNLMQSVAKALAGASVPHIGAYVPLTQEKVRKIKILK
DQLQXXXXASVLSEGWDFK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagcattgatttatgatgaggaaatgaccagtcataaactactttgg
aatgatcctatctgtgatatcgaagtgccagaaagactgtcaacctcctatgagcagctt
cagttttaccatcttgtggaaagatgcgtccatgtgcctgcccgagaaggaactgaagag
gagatcctgttagttcacagttcagaacacttggaagttgcaaaaagcacgcagacaatg
ggtgaagaggaactgaaaagagtgtctgggaattatgatgcttttttctttcatccgaac
acttaccgctgtgccagactagcagtgggagcaactttgcaactagtggactctgtgatg
ttaggaaaagtctgcaatggaatggcattagtaagacctccaggtcaccacagtcagaga
aatgcagctaacgggttctgtttattcaacaacgttgctattgcagcagaatatgcaaaa
ttgaaatacggtctacaaagaatcctcattgttgactgggatgtgcaccatgggcaagga
actcagtatatatttgaagaggatccaagtgttttgtatttttcctggcatcggtacgaa
catcaagaattctggccatctctcaaagaatctgattatgatgctgtaggtttgggaaaa
ggaaaaggctttaatataaatttgccttggaataaggttgggatgggaaactcagattat
cttgctgcattttttcatgtgttgcttccaatggcttttgagtttgatcctgaactggtt
cttgtctcctctggatatgattcaggaattggagaccctgaagggcagatgaatgccact
cctgaggtttttgcccaccttacccatttcctgatgcagttagctaatggaaaactgtgt
gtcatcctagagggtggatatcacttgaagtccttgtctgaatcagtctgcatgactgta
aaaactttgcttagagatcctatacctcaagtaactggagaaatggccccttgcctaagt
gctattgaatctattcagaatgtgagagcagcacataaaccctactggaaatggttgatg
tatgaagacacatcatttttgcataatttgagcaccaagtcacacttaccaaagacgact
aataccaatccctctacagaccttgaagataagataactaacaccagtgaagctgtcaaa
atagaaagatttctggaattgcacatgagaaatattctatttccagtgcctcccgtcaga
acagcaacaactgagtcaaaagcttcatcatacttgctcccagcacctgtttgtgtggtg
aaggaaatggacaaaaacgaagtgaaatctcttgccagtgacttttacgcagaccttgtg
aaagaggacaaaaccttgcactctcttggcagtatgttggccatcctagataaaatactg
aagaaggaggtatgcaatggaattgcagattcacccacagcttctgtttctgttgatgta
gcactaagatattctgttcattttggatttcaaagagtgctttgcatatttgttggagac
atgcagatcataccaaacacagaagatggaaaagtacttgtgataaatgtttgcgagaaa
gaacaatctggaaagatcggctctaaatactttatttctctgaactggaaagaggatgct
gacaggagtgacttcttttctgctgtacttggattcattcttcctgtagcatacagttat
cagcccaacttgatagtaatagctgttggaccaaacaggagcattggaataagtggaatt
tctcttcttttcggtttactacaaggactagcagaatctcgaattcttgcggtgattgag
gacacagatgtaaatctaatgcaaagtgtagccaaagcactagctggtgcttctgtgcct
cacattggagcttatgtacctctcacccaagaaaaagtacgtaaaataaaaatattaaaa
gaccaacttcagcannnnnnnnnngcttcagtgctcagtgaaggatgggatttcaagtaa

DBGET integrated database retrieval system